Xiphias gladius (swordfish): 120797524 Help Entry 120797524         CDS       T07311                                  Symbol cxcl19 Name (RefSeq) C-X-C motif chemokine 19   KO K10030   interleukin 8 Organism xgl  Xiphias gladius (swordfish) Pathway xgl04060   Cytokine-cytokine receptor interaction xgl04218   Cellular senescence xgl04620   Toll-like receptor signaling pathway xgl04621   NOD-like receptor signaling pathway xgl04622   RIG-I-like receptor signaling pathway xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120797524 (cxcl19)  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120797524 (cxcl19)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120797524 (cxcl19)    04621 NOD-like receptor signaling pathway     120797524 (cxcl19)    04622 RIG-I-like receptor signaling pathway     120797524 (cxcl19)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120797524 (cxcl19)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xgl04052]     120797524 (cxcl19)    00536 Glycosaminoglycan binding proteins [BR:xgl00536]     120797524 (cxcl19) Cytokines and neuropeptides [BR:xgl04052]  Cytokines   Chemokines    120797524 (cxcl19) Glycosaminoglycan binding proteins [BR:xgl00536]  Heparan sulfate / Heparin   Chemokines    120797524 (cxcl19) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120797524 NCBI-ProteinID:  XP_039997187 LinkDB All DBs Position LG12:13567491..13570801 Genome browser AA seq 105 aa AA seqDB search MKLCFLVMFLPPVALVNGMPPINKHYNTHCRCLQVESRIIPPDKLRSIKLVPESPHCPDT EVIAGLASGEKVCLNPRSSWVKKLIHLVLERQLHQQGRALPKNQS NT seq 318 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcttcctcgtcatgtttctaccccctgtggctcttgttaacggaatgccg ccgatcaacaagcactacaacacacactgtcggtgccttcaggtggagtcgaggatcatc cctccagacaaactgaggagcatcaagctagtccctgaaagccctcattgcccagacaca gaggtcatagctggactggcgagtggagagaaggtctgtttgaaccctcggtcctcgtgg gtgaagaagctgatccacttagttcttgagagacagctacatcagcaaggaagagcacta cccaagaatcaatcataa

DBGET integrated database retrieval system