Xiphias gladius (swordfish): 120799710 Help Entry 120799710         CDS       T07311                                  Name (RefSeq) interleukin-8-like   KO K10030   interleukin 8 Organism xgl  Xiphias gladius (swordfish) Pathway xgl04060   Cytokine-cytokine receptor interaction xgl04218   Cellular senescence xgl04620   Toll-like receptor signaling pathway xgl04621   NOD-like receptor signaling pathway xgl04622   RIG-I-like receptor signaling pathway xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     120799710  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     120799710  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     120799710    04621 NOD-like receptor signaling pathway     120799710    04622 RIG-I-like receptor signaling pathway     120799710  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120799710  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xgl04052]     120799710    00536 Glycosaminoglycan binding proteins [BR:xgl00536]     120799710 Cytokines and neuropeptides [BR:xgl04052]  Cytokines   Chemokines    120799710 Glycosaminoglycan binding proteins [BR:xgl00536]  Heparan sulfate / Heparin   Chemokines    120799710 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  120799710 NCBI-ProteinID:  XP_040000943 LinkDB All DBs Position LG15:17424622..17426018 Genome browser AA seq 99 aa AA seqDB search MMSSRVIVTATVVLLASLAISEGMNLRSTGVELHCRCIQTESKPIGRHIEKVELIPANSH CEETEIIATLKKTGVEVCLDPAAPWVKRVIDKILSNRRR NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgatgagcagcagagtcatcgtaactgctacagtggtgcttctggcctcattggccatc agtgaagggatgaatctgagaagcacaggagtggagctgcactgccgatgcatccagacg gagagcaaacccatcggccgccacattgagaaggtggagctgattcctgccaactctcac tgcgaggaaactgagatcattgccactctgaaaaaaacaggcgtagaggtctgcctagac ccagcggctccctgggtgaagagagtgattgacaagatcctgtccaacagaagacgctga

DBGET integrated database retrieval system