Xiphias gladius (swordfish): 120799761 Help Entry 120799761         CDS       T07311                                  Symbol pold4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism xgl  Xiphias gladius (swordfish) Pathway xgl03030   DNA replication xgl03410   Base excision repair xgl03420   Nucleotide excision repair xgl03430   Mismatch repair xgl03440   Homologous recombination Brite KEGG Orthology (KO) [BR:xgl00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     120799761 (pold4)    03410 Base excision repair     120799761 (pold4)    03420 Nucleotide excision repair     120799761 (pold4)    03430 Mismatch repair     120799761 (pold4)    03440 Homologous recombination     120799761 (pold4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:xgl03032]     120799761 (pold4)    03400 DNA repair and recombination proteins [BR:xgl03400]     120799761 (pold4) DNA replication proteins [BR:xgl03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     120799761 (pold4) DNA repair and recombination proteins [BR:xgl03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       120799761 (pold4)    MMR (mismatch excision repair)     DNA polymerase delta complex      120799761 (pold4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 Motif Other DBs NCBI-GeneID:  120799761 NCBI-ProteinID:  XP_040001042 LinkDB All DBs Position LG15:33734235..33742201 Genome browser AA seq 107 aa AA seqDB search MATKCGLITDSFKVVKKARRRGAQEKRPTPPPQKESETETVREEELQKLRQFDLDWRFGP CTGIGRLQRWERSKLHGLNPPEEIRGLLLKTHSDPKYKLSLWSEYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atggcaaccaagtgcggactgataactgattcattcaaggtggtaaagaaagcaaggagg aggggggcacaagagaagaggcctactcctccaccacaaaaagaatctgagactgaaaca gtcagagaagaggagctgcagaagctcagacagtttgatctggactggagatttgggccc tgcacaggtatcggcagactgcagagatgggagagatcaaagcttcatggtctgaaccca cctgaggagatcagaggcctgctgctgaaaacacactctgaccccaagtacaagctgagc ctatggagcgaatatcctttgtga

DBGET integrated database retrieval system