Xiphias gladius (swordfish): 120801691 Help Entry 120801691         CDS       T07311                                  Symbol mrasa Name (RefSeq) ras-related protein M-Ras   KO K07831   Ras-related protein M-Ras Organism xgl  Xiphias gladius (swordfish) Pathway xgl04010   MAPK signaling pathway xgl04137   Mitophagy - animal xgl04140   Autophagy - animal xgl04218   Cellular senescence xgl04371   Apelin signaling pathway xgl04519   Cadherin signaling xgl04625   C-type lectin receptor signaling pathway xgl04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120801691 (mrasa)    04371 Apelin signaling pathway     120801691 (mrasa)   09133 Signaling molecules and interaction    04519 Cadherin signaling     120801691 (mrasa)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120801691 (mrasa)    04137 Mitophagy - animal     120801691 (mrasa)   09143 Cell growth and death    04218 Cellular senescence     120801691 (mrasa)   09142 Cell motility    04810 Regulation of actin cytoskeleton     120801691 (mrasa)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     120801691 (mrasa)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:xgl04031]     120801691 (mrasa) GTP-binding proteins [BR:xgl04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     120801691 (mrasa) SSDB OrthologParalogGFIT Motif Pfam:  Ras Roc GTP_EFTU Arf RsgA_GTPase MMR_HSR1 ATP_bind_1 AAA_16 Motif Other DBs NCBI-GeneID:  120801691 NCBI-ProteinID:  XP_040004800 LinkDB All DBs Position LG16 Genome browser AA seq 208 aa AA seqDB search MATSAVPSDNLPTYKLVVVGDGGVGKSALTIQFFQKIFVPDYDPTIEDSYLKHTEIDGQW AILDVLDTAGQEEFSAMREQYMRTGDGFLIVFSVTDKASFEHVDRFHQLILRVKDREAFP MVLVANKVDLVHLRKVTTDQGQEMAAKHNITYIETSAKDPPMNVDKAFHELVRVIRQQVP ERNQKKKKKMKWRAERSTGSHRFHCAIL NT seq 627 nt NT seq  +upstreamnt  +downstreamnt atggcaaccagcgctgtgccaagtgacaacctgccaacgtacaagctggtggtggtgggg gatggtggtgttgggaagagcgccctcaccatccaattcttccagaagatctttgtgcca gactatgatcccacgatagaggactcatatctaaaacacacagagatagacgggcagtgg gcaatactggatgtgctggacacagctggccaggaagagttcagtgcaatgagagagcag tatatgaggacaggagacggcttcctcatagtcttctctgtgacagacaaggccagcttt gaacatgttgaccgattccatcaactcatactacgggttaaagacagggaggccttcccc atggtgttggtggcaaacaaagtggacctggtccatctgagaaaggtcaccactgaccag ggccaagagatggctgcaaaacataatataacttatatcgaaacaagtgctaaggatcct ccaatgaatgtggacaaagcctttcatgagctggtccgcgttataagacagcaagtccca gagcggaaccagaagaagaaaaagaagatgaagtggagagcagaacgttccacaggttcc cacaggttccactgtgccatattgtga

DBGET integrated database retrieval system