Xiphias gladius (swordfish): 120802773 Help Entry 120802773         CDS       T07311                                  Name (RefSeq) insulin   KO K04526   insulin Organism xgl  Xiphias gladius (swordfish) Pathway xgl04010   MAPK signaling pathway xgl04068   FoxO signaling pathway xgl04081   Hormone signaling xgl04114   Oocyte meiosis xgl04140   Autophagy - animal xgl04150   mTOR signaling pathway xgl04810   Regulation of actin cytoskeleton xgl04910   Insulin signaling pathway xgl04914   Progesterone-mediated oocyte maturation Brite KEGG Orthology (KO) [BR:xgl00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     120802773    04068 FoxO signaling pathway     120802773    04150 mTOR signaling pathway     120802773   09133 Signaling molecules and interaction    04081 Hormone signaling     120802773  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     120802773   09143 Cell growth and death    04114 Oocyte meiosis     120802773   09142 Cell motility    04810 Regulation of actin cytoskeleton     120802773  09150 Organismal Systems   09152 Endocrine system    04910 Insulin signaling pathway     120802773    04914 Progesterone-mediated oocyte maturation     120802773  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xgl04052]     120802773 Cytokines and neuropeptides [BR:xgl04052]  Neuropeptides   Unclassified    120802773 SSDB OrthologParalogGFIT Motif Pfam:  Insulin Motif Other DBs NCBI-GeneID:  120802773 NCBI-ProteinID:  XP_040006846 LinkDB All DBs Position LG17 Genome browser AA seq 116 aa AA seqDB search MAALWLQSVSLLVLLIVSWPGSQAVAPPQHLCGSHLVDALYLVCGDRGFFYNPKRDVDPL LGFLPPKAGGAAAAGGENEVAEFAFKDQMEMMVKRGIVEQCCHKPCNIFDLQNYCN NT seq 351 nt NT seq  +upstreamnt  +downstreamnt atggcggcgctgtggctccagtctgtctctctgctggtcttactgatcgtatcgtggcca ggctcccaggccgtcgcccccccacagcacctctgcggctctcacctggtcgacgccctc tacctggtctgtggggacagaggctttttctacaaccccaagagagacgtcgaccctctg ctgggtttcctccctccgaaggcgggcggagctgcggcggcgggcggcgagaacgaagtg gccgagttcgccttcaaggaccagatggagatgatggtgaagcggggcatcgtggagcag tgctgccacaagccctgcaacatcttcgacctgcagaactactgcaactga

DBGET integrated database retrieval system