Xiphias gladius (swordfish): 120807567 Help Entry 120807567         CDS       T07311                                  Name (RefSeq) ras-related protein rab7-like   KO K07897   Ras-related protein Rab-7A Organism xgl  Xiphias gladius (swordfish) Pathway xgl04137   Mitophagy - animal xgl04140   Autophagy - animal xgl04144   Endocytosis xgl04145   Phagosome xgl04148   Efferocytosis xgl05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xgl00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     120807567    04145 Phagosome     120807567    04140 Autophagy - animal     120807567    04137 Mitophagy - animal     120807567    04148 Efferocytosis     120807567  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     120807567  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xgl04131]     120807567   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xgl04147]     120807567    04031 GTP-binding proteins [BR:xgl04031]     120807567 Membrane trafficking [BR:xgl04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     120807567 Exosome [BR:xgl04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    120807567   Exosomal proteins of other body fluids (saliva and urine)    120807567   Exosomal proteins of colorectal cancer cells    120807567   Exosomal proteins of bladder cancer cells    120807567 GTP-binding proteins [BR:xgl04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     120807567 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW PduV-EutP nSTAND3 Septin AAA_16 AAA_7 NTPase_1 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB ABC_tran ATP-synt_ab Motif Other DBs NCBI-GeneID:  120807567 NCBI-ProteinID:  XP_040015698 LinkDB All DBs Position LG21:complement(18013763..18023346) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVTTKRAQAWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNDRAKPSAESCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatccaggaagaaagtgctcttgaaagtcatcatcctgggagattctggtgttgga aagacctccctaatgaaccagtatgtgaacaagaagtttagtaaccagtacaaagctaca ataggagcagacttcctgaccaaggaggtgatggtggacgaccggctcgttacaatgcag atctgggacacggctggccaggagagattccagtccttgggtgttgcgttctaccgtgga gcggactgctgtgtgctggtgtttgatgtgaccgcacccaataccttcaagacactcgac agctggagggatgagtttctgatccaggccagcccccgtgatcctgagaacttccccttt gtggtgctaggcaacaagattgacttggagaatagacaggtaaccaccaaaagggctcag gcttggtgtcagagtaagaacaacatcccctactttgagaccagtgccaaagaagccata aatgtagaacaggcattccagacaattgcacgtaacgccctcaaacaggagacagaggtg gagttgtataatgaattcccagagcccataaaactggataggaatgacagagctaaacct tcagcagaaagctgcagctgctaa

DBGET integrated database retrieval system