Xanthomonas graminis: KFS84_00235 Help Entry KFS84_00235       CDS       T10672                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xgm  Xanthomonas graminis Pathway xgm01100   Metabolic pathways xgm01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xgm00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     KFS84_00235    00074 Mycolic acid biosynthesis     KFS84_00235   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     KFS84_00235 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  UKE54487 LinkDB All DBs Position complement(57667..57936) Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPGDIDPEAPLFNTGLGLDSIDALELALAISKRYGF QLRSDNDENRRIFASLRALSAHVEANKTS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgcaaaccgccgccgaacgtgaactggccgagctgctggtcgagagcctgaac ctggaggacgtgcagcccggcgacatcgatccagaagcgccgctgttcaataccgggttg ggcctggactcgatcgacgcgctggagctggcgctggcgatcagcaagcgctatggcttc cagctgcgctcggacaacgacgagaaccgccgcatcttcgcctcgctgcgcgcactgtcg gcgcatgtcgaagccaacaagaccagctga

DBGET integrated database retrieval system