Xanthomonas graminis: KFS84_04625 Help Entry KFS84_04625       CDS       T10672                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xgm  Xanthomonas graminis Pathway xgm00290   Valine, leucine and isoleucine biosynthesis xgm00650   Butanoate metabolism xgm00660   C5-Branched dibasic acid metabolism xgm00770   Pantothenate and CoA biosynthesis xgm01100   Metabolic pathways xgm01110   Biosynthesis of secondary metabolites xgm01210   2-Oxocarboxylic acid metabolism xgm01230   Biosynthesis of amino acids Module xgm_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xgm_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xgm00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     KFS84_04625    00660 C5-Branched dibasic acid metabolism     KFS84_04625   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     KFS84_04625   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     KFS84_04625 Enzymes [BR:xgm01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      KFS84_04625 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  UKE55134 LinkDB All DBs Position complement(1053376..1053624) Genome browser AA seq 82 aa AA seqDB search MRYQLDLVLKPVEGALLRAIGMAERRGFAPLSIRGAPAPDDAGRWHLQMVVDGTRPGESL RLQMEKVYDCESVRVTALDVAP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgataccagcttgacctggtgctgaagccggtcgaaggcgcgctgctgcgcgcgatc ggcatggccgagcggcgcggcttcgcgccgctgtcgatccgcggcgcgccggcgcccgac gacgccggccgctggcacctgcagatggtggtggacggcactcgccccggcgagagcctg cgcctgcagatggagaaggtgtacgactgtgagtcggtgcgggtgactgcgctggatgta gcgccatga

DBGET integrated database retrieval system