Xanthomonas graminis: KFS84_19040 Help Entry KFS84_19040       CDS       T10672                                  Symbol atpE Name (GenBank) F0F1 ATP synthase subunit C   KO K02110   F-type H+-transporting ATPase subunit c Organism xgm  Xanthomonas graminis Pathway xgm00190   Oxidative phosphorylation xgm01100   Metabolic pathways Module xgm_M00157   F-type ATPase, prokaryotes and chloroplasts Brite KEGG Orthology (KO) [BR:xgm00001]  09100 Metabolism   09102 Energy metabolism    00190 Oxidative phosphorylation     KFS84_19040 (atpE)  09180 Brite Hierarchies   09181 Protein families: metabolism    00194 Photosynthesis proteins [BR:xgm00194]     KFS84_19040 (atpE) Photosynthesis proteins [BR:xgm00194]  Photosystem and electron transport system   F-type ATPase [OT]    KFS84_19040 (atpE) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ATP-synt_C DUF1129 Motif Other DBs NCBI-ProteinID:  UKE54197 LinkDB All DBs Position complement(4287085..4287384) Genome browser AA seq 99 aa AA seqDB search MSFAVLTNLAQVQSSTVLAVGIMIGLAALGAGLGLAIMAGKFLESAARQPELIPVLQVRM FITAGLIDAAFIISVAVGLLFAFANPMIGEFVSRLPQGG NT seq 300 nt NT seq  +upstreamnt  +downstreamnt atgtccttcgccgtcctgaccaacctcgcccaagtccagagctccaccgtcctcgccgtc ggcatcatgatcggcctggccgcgctgggtgccggcctcggtctggccatcatggccggc aagttcctggagtcggccgcgcgccagccggaactgatcccggtgctgcaggtgcgcatg ttcatcaccgccggcctgatcgacgccgcgttcatcatcagcgtcgcggtcggcctgctg ttcgcgttcgccaacccgatgatcggcgagttcgtgtcgcgcctgccgcagggcggctga

DBGET integrated database retrieval system