Xenorhabdus griffiniae: QL128_02695 Help Entry QL128_02695       CDS       T09400                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xgr  Xenorhabdus griffiniae Pathway xgr00998   Biosynthesis of various antibiotics xgr01100   Metabolic pathways xgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QL128_02695    00074 Mycolic acid biosynthesis     QL128_02695   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QL128_02695 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF4809 PP-binding_2 Motif Other DBs NCBI-ProteinID:  WMV74377 LinkDB All DBs Position complement(602185..602436) Genome browser AA seq 83 aa AA seqDB search MMEKQAIFQEVSQLLVQLFELSPEDITPESRLYEDLELDSIDAVDMVVHLQKKTGRKIKP ETFKSVRTVQDVVDAVEQLLQEQ NT seq 252 nt NT seq  +upstreamnt  +downstreamnt atcatggaaaaacaagcaatttttcaggaagtctcccaattattagttcagttgtttgaa ctgtctcccgaagacattacacccgagtcacgactttatgaggatttggaactcgatagc attgatgccgttgatatggttgtacatttacaaaagaaaactgggcgcaaaatcaaaccc gaaacattcaaatctgtacgcaccgtacaggacgtcgtggatgccgtagaacaattgttg caagaacaataa

DBGET integrated database retrieval system