Xenorhabdus griffiniae: QL128_07645 Help Entry QL128_07645       CDS       T09400                                  Symbol acpP Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xgr  Xenorhabdus griffiniae Pathway xgr00998   Biosynthesis of various antibiotics xgr01100   Metabolic pathways xgr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xgr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     QL128_07645 (acpP)    00074 Mycolic acid biosynthesis     QL128_07645 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     QL128_07645 (acpP) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 Ribosomal_L12_N DUF5783 Ribosomal_L50 DUF5798 Motif Other DBs NCBI-ProteinID:  WMV73863 LinkDB All DBs Position 1646585..1646821 Genome browser AA seq 78 aa AA seqDB search MSTIDERVKKIIVEQLGVKEEEVVNTASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDYVENAGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgacgaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagag gaagaagttgtgaacacagcttcatttgttgatgacttgggcgctgattctcttgacaca gttgaactggtaatggctctggaagaagagttcgatatcgagatcccagacgaagaagct gaaaaaatcactacagttcaagctgctattgactacgttgaaaacgcaggtaaataa

DBGET integrated database retrieval system