Xenorhabdus griffiniae: QL128_19355 Help Entry QL128_19355       CDS       T09400                                  Symbol hfq Name (GenBank) RNA chaperone Hfq   KO K03666   host factor-I protein Organism xgr  Xenorhabdus griffiniae Pathway xgr02024   Quorum sensing xgr03018   RNA degradation Brite KEGG Orthology (KO) [BR:xgr00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    03018 RNA degradation     QL128_19355 (hfq)  09140 Cellular Processes   09145 Cellular community - prokaryotes    02024 Quorum sensing     QL128_19355 (hfq)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xgr03019]     QL128_19355 (hfq)    03036 Chromosome and associated proteins [BR:xgr03036]     QL128_19355 (hfq) Messenger RNA biogenesis [BR:xgr03019]  Prokaryotic type   Bacterial mRNA degradation factors    Other RNA degradation factors     Chaperones      QL128_19355 (hfq) Chromosome and associated proteins [BR:xgr03036]  Prokaryotic type   Nucleoid associated proteins    Other nucleoid associated proteins     QL128_19355 (hfq) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Hfq LSM Hfq_1 Motif Other DBs NCBI-ProteinID:  WMV72223 LinkDB All DBs Position complement(4235886..4236188) Genome browser AA seq 100 aa AA seqDB search MAKGQSLQDPFLNALRRERVPVSIYLVNGIKLQGQIESFDQFVILLKNTVSQMVYKHAIS TVVPSRPVSHHGNNQNVPTSVGNYHAGTNSTVQQEGDGAE NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atggctaaggggcaatctttgcaagatccattcctgaacgctttacgacgtgaaagggtc ccggtttctatttatttggtaaacggcatcaagttgcagggtcagattgaatcttttgac caatttgtcattttactgaagaacacggttagtcagatggtttataaacatgccatctct actgttgtgccttcccgtcctgtgtctcatcatggtaacaaccagaatgtaccaactagt gttggaaattatcatgcgggcactaactcgacagtacaacaggaaggcgatggcgctgaa taa

DBGET integrated database retrieval system