KEGG   Xanthomonas hawaiiensis: PG878_13730
Entry
PG878_13730       CDS       T09990                                 
Symbol
coaD
Name
(GenBank) pantetheine-phosphate adenylyltransferase
  KO
K00954  pantetheine-phosphate adenylyltransferase [EC:2.7.7.3]
Organism
xha  Xanthomonas hawaiiensis
Pathway
xha00770  Pantothenate and CoA biosynthesis
xha01100  Metabolic pathways
xha01240  Biosynthesis of cofactors
Module
xha_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:xha00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    PG878_13730 (coaD)
Enzymes [BR:xha01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.3  pantetheine-phosphate adenylyltransferase
     PG878_13730 (coaD)
SSDB
Motif
Pfam: CTP_transf_like
Other DBs
NCBI-ProteinID: WNH43585
LinkDB
Position
complement(3190598..3191104)
AA seq 168 aa
MTVAHSRIAVYPGTFDPITNGHIDLVNRAAPLFEQVIVGVAQSPSKGPTLPLELRVSLAR
EALAGHRNVEVLGFDTLLAHFVRSVGGGVLLRGLRAVSDFEYEFQMASMNRHLIPEVETL
FLTPAEQHSFISSSLVREIARLGGDVSGFVPPSVVQALVQARQAAAQR
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaccgtggcccatagccgcatcgccgtctatcccggcaccttcgatccgatcaccaac
ggccatatcgatctggtcaaccgtgccgcaccgctgttcgagcaggtgatcgtgggcgtg
gcgcagagcccgtccaaggggccgaccctgccgctggaactgcgcgtgtcgctggcccgc
gaggcgctggcggggcaccgcaacgtggaagtgctgggcttcgacaccctgctggcgcat
ttcgtgcgctcggtcggcggcggcgtgctgctgcgcggcctgcgcgcggtgtcggatttc
gaatacgagttccagatggcgagcatgaaccggcatctgatcccggaggtggagacgctg
ttcctcaccccggccgagcaacacagcttcatttcgtcctcgttggtgcgcgagatcgcg
cgcctgggcggggacgtctccggcttcgtgccgccgtcggtggtgcaggcgctggtccag
gcccgccaggccgccgcgcagcgctga

DBGET integrated database retrieval system