KEGG   Xanthomonas hydrangeae: LMG31886_20440
Entry
LMG31886_20440    CDS       T07925                                 
Symbol
msbA_1
Name
(GenBank) Lipid A export ATP-binding/permease protein MsbA
  KO
K11085  ATP-binding cassette, subfamily B, bacterial MsbA [EC:7.5.2.6]
Organism
xhd  Xanthomonas hydrangeae
Pathway
xhd02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:xhd00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    LMG31886_20440 (msbA_1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xhd02000]
    LMG31886_20440 (msbA_1)
Enzymes [BR:xhd01000]
 7. Translocases
  7.5  Catalysing the translocation of carbohydrates and their derivatives
   7.5.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.5.2.6  ABC-type lipid A-core oligosaccharide transporter
     LMG31886_20440 (msbA_1)
Transporters [BR:xhd02000]
 ABC transporters, eukaryotic type
  ABCB (MDR/TAP) subfamily
   ABCB-BAC subgroup
    LMG31886_20440 (msbA_1)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_16 ABC_ATPase AAA_30 nSTAND1 AAA_22 AAA_29 AAA_21 DUF3584 RsgA_GTPase HUTI_composite_bact DUF87 MMR_HSR1 AAA_23 AAA_15
Other DBs
NCBI-ProteinID: CAD7734243
LinkDB
Position
LMG31886:2441905..2443674
AA seq 589 aa
MTPSNDRPAPASSWRTYRRLLAFAKPYRLLLIAALIAALVEAAGTTGFLALMKPITDETF
IYKNAEVSRWLPVQIILLFVVRGIAGYITDMAMGKSARSIARDLRVKVMSKYLRLPGSRF
DSEPVPSMLIRLGSDSDQVAQAAVDAVKVMIQQSLQVIGALALMLWHSWQVTLTILVLAP
VLAWVMDKVARRYRRISHSIQESGAHLLQAADQTLSSHQEVKIYGAQQTEMERYGALADR
NLRLAMKVESTRGISTATVQMIGAIGLSALLFVAGAQALAGRLTAGDFVVLMTSMLTIIP
GLKQLTNVQNMVQRGLASAERLFSVLDSPDEPDQGAIPLKRAKGLIEFRDVTARYPGQVN
PALAGVSFVAQPGTVTAIVGRSGSGKSSLIKLIPRFYEAEAGQILLDGHPVQAYALADLR
RQIALVGQQVMLFDGSIADNVAYGEMRSADASQLERAILGANAMEFVAQLPDGLQSHVGT
KGGRLSGGQRQRLAIARAMLKDAPILILDEATAALDNESERLVQDALHKLMPDRTTLVIA
HRLSTIEHADQVLVMDQGRIVERGTHSELLAQGGLYSHLHGMQFRERQA
NT seq 1770 nt   +upstreamnt  +downstreamnt
gtgactccttccaacgaccgcccggcgccagcatcgtcctggcgcacgtaccgtcgcctg
ctggccttcgccaagccgtaccgtctgttgctgatcgccgcgctgattgccgcgctggtc
gaagcggcgggcaccaccggctttctggcgttgatgaagccgatcaccgacgaaaccttc
atctacaagaacgccgaagtcagtcgctggctgccggtgcagatcatcctgttgttcgtg
gtgcgcggcattgccggttacatcaccgatatggcgatgggcaagtccgcgcgcagcatc
gcgcgcgatctgcgtgtcaaggtgatgtccaagtatctgcgcctgccgggatcgcggttc
gattccgagccggtgccgtcgatgctgatacgcctgggttcggactcggatcaagtggcg
caggcggcggtggatgcggtcaaggtgatgatccagcagtcgttgcaggtgatcggtgcg
ttggcgctgatgctgtggcatagctggcaggtcacgctgaccatcctggtgctggcaccg
gtgctggcctgggtgatggacaaggtggcgcgacgctatcgccgcatcagccacagcatc
caggaaagcggcgcgcatctgttgcaggcggccgaccagaccttgtccagccatcaggag
gtcaagatctacggcgcgcaacagaccgaaatggagcgctacggcgcgctggccgaccgc
aatctgcggctggcgatgaaggtcgaatccacgcgtggcatttccacggccaccgtgcag
atgatcggcgcgatcggtctgtcggcgctgttgttcgtggccggtgcgcaggcactggcg
gggcggctgaccgcaggcgacttcgtggtgctgatgacctcgatgctgacgattattcct
ggcctcaagcagctcaccaatgtgcagaacatggtgcaacgcggcctggcgtcggccgag
cgcctgttctcggtgctcgacagccccgacgagccggaccaaggcgcgatcccgctcaag
cgtgcgaagggcttgatcgaattccgcgatgtcactgcgcgctatccgggtcaggtgaat
ccggcgctggcgggggtgagtttcgttgcgcagccgggcacggtgacggcgattgtcggg
cgctcgggcagcggtaaatccagcctgatcaagctgattccgcgcttctacgaagccgag
gccgggcagatcctgctcgacggtcatccagtgcaggcgtacgcgttggccgatctgcgc
cggcagatcgcgctggtcggccaacaggtgatgttgttcgacggcagcatcgccgacaac
gtggcctatggcgaaatgcgcagcgcagatgcgagccagttggagcgcgcgattctgggt
gccaatgcgatggagttcgtcgcgcagttgccggacggtttgcaatcgcacgtgggcacc
aagggcgggcgtctgtccggcgggcagcgccagcgcttggcgatcgcgcgcgcgatgctc
aaggacgcgccgatcctgattctggacgaagccaccgccgcgctggacaacgaatccgaa
cggctggtgcaggacgccttgcacaagctgatgccggaccgcaccacgctggtgatcgcg
caccgcctgtccacgatcgaacatgccgatcaggtactggtgatggatcagggccgcatc
gtcgagcgcggtacgcacagtgaattgctggcgcagggcgggttgtattcgcacctgcac
ggcatgcagttccgcgaacggcaggcatga

DBGET integrated database retrieval system