Xanthomonas hydrangeae: LMG31886_32220 Help Entry LMG31886_32220    CDS       T07925                                  Symbol acpP Name (GenBank) Acyl carrier protein   KO K02078   acyl carrier protein Organism xhd  Xanthomonas hydrangeae Pathway xhd01100   Metabolic pathways xhd01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xhd00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     LMG31886_32220 (acpP)    00074 Mycolic acid biosynthesis     LMG31886_32220 (acpP)   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     LMG31886_32220 (acpP) BRITE hierarchy SSDB OrthologParalogGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C DUF1896 Motif Other DBs NCBI-ProteinID:  CAD7741461 LinkDB All DBs Position LMG31886:complement(3845800..3846039) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggct gagaagatcacctcggtccagcaggccatcgactacgtcaaggctcacgtcaagagctga

DBGET integrated database retrieval system