Xiphophorus hellerii (green swordtail): 116708694 Help Entry 116708694         CDS       T07363                                  Name (RefSeq) metallothionein   KO K14739   metallothionein 1/2 Organism xhe  Xiphophorus hellerii (green swordtail) Brite KEGG Orthology (KO) [BR:xhe00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03019 Messenger RNA biogenesis [BR:xhe03019]     116708694    03029 Mitochondrial biogenesis [BR:xhe03029]     116708694 Messenger RNA biogenesis [BR:xhe03019]  Eukaryotic type   mRNA surveillance and transport factors    Factors involved in mRNA localization     Factors that have mRNA localization signals      116708694 Mitochondrial biogenesis [BR:xhe03029]  Mitochondrial quality control factors   Regulator of mitochondrial biogenesis    Nuclear respiratory factors     116708694 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Metallothio Motif Other DBs NCBI-GeneID:  116708694 NCBI-ProteinID:  XP_032402538 LinkDB All DBs Position 2:297603..298207 Genome browser AA seq 60 aa AA seqDB search MDPCDCAKTGKCNCGGSCTCANCSCKSCKKSCCSCCPSGCSKCASGCVCKGKTCDKSCCQ NT seq 183 nt NT seq  +upstreamnt  +downstreamnt atggatccctgcgactgcgccaagactggaaaatgtaactgcggaggttcctgcacctgc gcgaactgctcctgcaaatcctgcaagaaaagctgctgctcttgctgcccatcaggctgc agtaaatgcgcctctggctgcgtgtgcaaagggaagacctgcgacaagagctgctgtcag tga

DBGET integrated database retrieval system