Xiphophorus hellerii (green swordtail): 116710022 Help Entry 116710022         CDS       T07363                                  Name (RefSeq) ras-related protein rab7   KO K07897   Ras-related protein Rab-7A Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04137   Mitophagy - animal xhe04140   Autophagy - animal xhe04144   Endocytosis xhe04145   Phagosome xhe04148   Efferocytosis xhe05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xhe00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116710022    04145 Phagosome     116710022    04140 Autophagy - animal     116710022    04137 Mitophagy - animal     116710022    04148 Efferocytosis     116710022  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116710022  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xhe04131]     116710022   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xhe04147]     116710022    04031 GTP-binding proteins [BR:xhe04031]     116710022 Membrane trafficking [BR:xhe04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     116710022 Exosome [BR:xhe04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    116710022   Exosomal proteins of other body fluids (saliva and urine)    116710022   Exosomal proteins of colorectal cancer cells    116710022   Exosomal proteins of bladder cancer cells    116710022 GTP-binding proteins [BR:xhe04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     116710022 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf MMR_HSR1 GTP_EFTU Gtr1_RagA RsgA_GTPase ATP_bind_1 cobW nSTAND3 PduV-EutP Septin AAA_7 NTPase_1 AAA_16 AAA_22 AAA_24 G-alpha AAA_5 ATPase_2 NACHT NB-ARC AAA_14 SRPRB FLYWCH_N ATP-synt_ab ABC_tran Motif Other DBs NCBI-GeneID:  116710022 NCBI-ProteinID:  XP_032404699 LinkDB All DBs Position 20:complement(26767091..26774929) Genome browser AA seq 207 aa AA seqDB search MTSRKKVLLKVIILGDSGVGKTSLMNQYVNKKFSNQYKATIGADFLTKEVMVDDRLVTMQ IWDTAGQERFQSLGVAFYRGADCCVLVFDVTAPNTFKTLDSWRDEFLIQASPRDPENFPF VVLGNKIDLENRQVPTKRAQIWCQSKNNIPYFETSAKEAINVEQAFQTIARNALKQETEV ELYNEFPEPIKLDRNERAKPSAETCSC NT seq 624 nt NT seq  +upstreamnt  +downstreamnt atgacatcaaggaagaaagttctactcaaagtcatcatccttggagactctggagttggg aagacctcactaatgaaccagtatgtgaataagaagttcagcaaccagtacaaagccacg attggcgccgatttcctgacgaaagaagtcatggtggatgacagacttgtcacaatgcag atttgggacacagcaggtcaggagaggttccagtctttgggtgtagctttctaccgtgga gcagactgctgtgtgctggtgttcgatgtgaccgcacccaacaccttcaagaccctagac agctggagagacgagttcttgatccaggccagcccacgagacccagagaatttccctttt gtggtgctgggcaacaagattgacctggagaacagacaggtaccaaccaaacgggcacag atttggtgtcagagcaagaacaacatcccatattttgaaaccagcgccaaggaggcaatc aacgtggagcaggctttccagactatcgcacgcaacgctcttaaacaggaaaccgaagtg gagttgtacaacgagttccccgagccaataaagctggacaggaacgagcgagccaagcct tcagcagagacctgcagctgctga

DBGET integrated database retrieval system