Xiphophorus hellerii (green swordtail): 116710395 Help Entry 116710395         CDS       T07363                                  Name (RefSeq) centromere protein S-like   KO K11511   centromere protein S Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:xhe00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     116710395  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xhe03036]     116710395    03400 DNA repair and recombination proteins [BR:xhe03400]     116710395 Chromosome and associated proteins [BR:xhe03036]  Eukaryotic type   Centromeric chromatin formation proteins    Kinetochore proteins     Centromere proteins      116710395 DNA repair and recombination proteins [BR:xhe03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      116710395 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-S CENP-T_C Histone CCDC-167 ZapG-like TFIID-31kDa DUF7229 Serine_rich Motif Other DBs NCBI-GeneID:  116710395 NCBI-ProteinID:  XP_032405308 LinkDB All DBs Position 20:complement(14894523..14897481) Genome browser AA seq 126 aa AA seqDB search MYRYFLLTKKETRQRLKAAVHYTVGRLCQKIEEEHRREFSRQTIAAIAETTFRECDIFAK DLEAFARHAKRSTVSAEDVKLLARRSRALSNHIQNKSEELAQEQRESRKKSTVKRKSRET EEESRE NT seq 381 nt NT seq  +upstreamnt  +downstreamnt atgtaccgctatttcttgttgacaaagaaggaaactcgtcagaggttgaaggcagcggtt cattatacggtgggtcgtttgtgtcagaagatcgaagaagaacaccggagggagttcagc cgacagaccatagcagccatagcggaaacgacattcagagagtgcgacatctttgccaag gatctggaagcttttgccagacatgccaaaagaagcacagtgtctgcagaggatgtaaaa cttctagcccgccgcagtagagctctgtccaaccacatacaaaataaaagtgaagaactg gcccaggagcagcgagagtccagaaagaagagtacagtgaagaggaagagcagagagacc gaggaggagagcagagaatga

DBGET integrated database retrieval system