Xiphophorus hellerii (green swordtail): 116714383 Help Entry 116714383         CDS       T07363                                  Symbol apln Name (RefSeq) apelin   KO K05225   apelin Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04080   Neuroactive ligand-receptor interaction xhe04371   Apelin signaling pathway Brite KEGG Orthology (KO) [BR:xhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     116714383 (apln)   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     116714383 (apln)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xhe04052]     116714383 (apln) Cytokines and neuropeptides [BR:xhe04052]  Neuropeptides   Neuropeptides (GPCR binding)    116714383 (apln) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Apelin PDGLE Motif Other DBs NCBI-GeneID:  116714383 NCBI-ProteinID:  XP_032410815 LinkDB All DBs Position 23:8850070..8887754 Genome browser AA seq 75 aa AA seqDB search MNVKILTLVIVLLVSLLCPAGAGPMASTEHGRGLEEAATVRKMAQQNPVRGGQTHRPAKR RRPRPRLSHKGPMPF NT seq 228 nt NT seq  +upstreamnt  +downstreamnt atgaatgtgaagatcctgacgctggtgattgtgctcttggtgtctctgctgtgtcctgcc ggtgctggtcccatggcctccacggagcatggcagagggctggaagaggcagctacagtg agaaaaatggcccagcagaacccagtgagaggcggtcagacccacagaccagccaagaga agacgcccacggccccgtctttcccacaaggggccaatgccgttctag

DBGET integrated database retrieval system