Xiphophorus hellerii (green swordtail): 116718639 Help Entry 116718639         CDS       T07363                                  Symbol calml4 Name (RefSeq) calmodulin-like protein 4   KO K02183   calmodulin Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04020   Calcium signaling pathway xhe04070   Phosphatidylinositol signaling system xhe04114   Oocyte meiosis xhe04218   Cellular senescence xhe04261   Adrenergic signaling in cardiomyocytes xhe04270   Vascular smooth muscle contraction xhe04371   Apelin signaling pathway xhe04625   C-type lectin receptor signaling pathway xhe04744   Phototransduction xhe04910   Insulin signaling pathway xhe04912   GnRH signaling pathway xhe04916   Melanogenesis Brite KEGG Orthology (KO) [BR:xhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04371 Apelin signaling pathway     116718639 (calml4)    04020 Calcium signaling pathway     116718639 (calml4)    04070 Phosphatidylinositol signaling system     116718639 (calml4)  09140 Cellular Processes   09143 Cell growth and death    04114 Oocyte meiosis     116718639 (calml4)    04218 Cellular senescence     116718639 (calml4)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116718639 (calml4)   09152 Endocrine system    04910 Insulin signaling pathway     116718639 (calml4)    04912 GnRH signaling pathway     116718639 (calml4)    04916 Melanogenesis     116718639 (calml4)   09153 Circulatory system    04261 Adrenergic signaling in cardiomyocytes     116718639 (calml4)    04270 Vascular smooth muscle contraction     116718639 (calml4)   09157 Sensory system    04744 Phototransduction     116718639 (calml4)  09180 Brite Hierarchies   09181 Protein families: metabolism    01009 Protein phosphatases and associated proteins [BR:xhe01009]     116718639 (calml4)   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xhe04131]     116718639 (calml4)    03036 Chromosome and associated proteins [BR:xhe03036]     116718639 (calml4)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xhe04147]     116718639 (calml4) Protein phosphatases and associated proteins [BR:xhe01009]  Protein serine/threonine phosphatases   Phosphoprotein phosphatases (PPPs)    Calcineurin (PPP3/ PP2B)     Regulatory subunits      116718639 (calml4) Membrane trafficking [BR:xhe04131]  Exocytosis   Small GTPases and associated proteins    Rab associated proteins     116718639 (calml4) Chromosome and associated proteins [BR:xhe03036]  Eukaryotic type   Centrosome formation proteins    Centrosome duplication proteins     Centriole replication proteins      116718639 (calml4) Exosome [BR:xhe04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116718639 (calml4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  EF-hand_7 EF-hand_1 EF-hand_6 EF-hand_8 EF-hand_9 AIF-1 EF-hand_5 EF_EFCAB10_C GPHH EH EF-hand_11 p25-alpha Motif Other DBs NCBI-GeneID:  116718639 NCBI-ProteinID:  XP_032416679 LinkDB All DBs Position 4:complement(25915865..25921278) Genome browser AA seq 153 aa AA seqDB search MAKFFTPAQISEFKECFSLYDKKQKGKIESKDLITVMRCLGTSPTLGEIERHLQVQKIGK TGEVDFSTFLIMMHRQMQQEDPKNEILEAFRMTDKQKKGQIQAAELRAKLTTLGEKLTNK EVDDLFKEANVKSNGIINYEAFTQMVTLPPVDY NT seq 462 nt NT seq  +upstreamnt  +downstreamnt atggctaagttctttacaccagctcaaatcagcgagttcaaagaatgcttctccttgtac gacaaaaagcagaagggtaaaatcgagtcaaaagatctgataacagttatgcgctgcctg ggaacaagccccacgcttggcgaaatagaaaggcatcttcaagtccaaaaaatcggaaag acaggcgaagtagacttctctaccttcctgatcatgatgcacaggcagatgcagcaggaa gacccgaagaatgaaatcctggaggcctttaggatgacggacaagcagaagaaaggacag atccaggcagctgagctacgggccaagctgaccaccttaggagagaaactcacaaacaaa gaagtggacgacctcttcaaagaagcaaacgtcaagtcaaacggcatcattaactatgaa gcgtttactcaaatggtgacacttccaccagtcgattattga

DBGET integrated database retrieval system