Xiphophorus hellerii (green swordtail): 116718813 Help Entry 116718813         CDS       T07363                                  Symbol rras2 Name (RefSeq) ras-related protein R-Ras2   KO K07830   Ras-related protein R-Ras2 Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04010   MAPK signaling pathway xhe04137   Mitophagy - animal xhe04140   Autophagy - animal xhe04218   Cellular senescence xhe04371   Apelin signaling pathway xhe04625   C-type lectin receptor signaling pathway xhe04810   Regulation of actin cytoskeleton Brite KEGG Orthology (KO) [BR:xhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116718813 (rras2)    04371 Apelin signaling pathway     116718813 (rras2)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     116718813 (rras2)    04137 Mitophagy - animal     116718813 (rras2)   09143 Cell growth and death    04218 Cellular senescence     116718813 (rras2)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116718813 (rras2)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116718813 (rras2)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xhe04147]     116718813 (rras2)    04031 GTP-binding proteins [BR:xhe04031]     116718813 (rras2) Exosome [BR:xhe04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    116718813 (rras2)   Exosomal proteins of bladder cancer cells    116718813 (rras2) GTP-binding proteins [BR:xhe04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116718813 (rras2) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 SLFN-g3_helicase ATP_bind_1 FeoB_N Motif Other DBs NCBI-GeneID:  116718813 NCBI-ProteinID:  XP_032416934 LinkDB All DBs Position 4:complement(18469468..18506234) Genome browser AA seq 202 aa AA seqDB search MAGWKDGSVQEKYRLVVVGGGGVGKSALTIQFIQSYFVTDYDPTIEDSYTKQCVIDERPA RLDILDTAGQEEFGAMREQYMRTGEGFLLVFSVTDRGSFEEIYKFQRQILRVKDRDEFPM ILVGNKADLELQRQVTQEEGQQLARQLKVTYMEASAKIRMNVDQAFHELVRVIRKFQEQE CPPSPEPTRNEKDKTGCHCVIV NT seq 609 nt NT seq  +upstreamnt  +downstreamnt atggctggctggaaggacggctcggtgcaggagaagtaccgtctggtcgtggtcggaggc ggtggcgtcgggaaatcagccttgactatccagtttattcagtcatactttgtcactgac tatgatcctacgatcgaagactcttacaccaagcagtgcgtgattgatgaaaggccggcc aggctggacatcctcgacacggctggacaggaagagttcggagccatgagagaacaatac atgaggacaggggagggcttcctgctcgtcttctcagtcactgacagaggaagctttgaa gaaatctacaaattccaaagacagattctgcgagtcaaagacagagatgaattccccatg atcctcgtaggcaacaaggcagatctggagctgcagagacaagtaacccaggaagagggc cagcagctggccagacagttaaaagtcacatatatggaggcttcagctaaaattcgtatg aacgtagaccaggcttttcatgagctggttagggtaatcaggaaattccaagaacaagaa tgtccaccgtcgccggagcctacgagaaatgagaaagacaaaaccggctgtcattgtgtg atcgtctga

DBGET integrated database retrieval system