Xiphophorus hellerii (green swordtail): 116719230 Help Entry 116719230         CDS       T07363                                  Symbol pole3 Name (RefSeq) DNA polymerase epsilon subunit 3   KO K02326   DNA polymerase epsilon subunit 3 [EC:2.7.7.7] Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe03030   DNA replication xhe03082   ATP-dependent chromatin remodeling xhe03410   Base excision repair xhe03420   Nucleotide excision repair Brite KEGG Orthology (KO) [BR:xhe00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     116719230 (pole3)    03410 Base excision repair     116719230 (pole3)    03420 Nucleotide excision repair     116719230 (pole3)   09126 Chromosome    03082 ATP-dependent chromatin remodeling     116719230 (pole3)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:xhe03032]     116719230 (pole3)    03036 Chromosome and associated proteins [BR:xhe03036]     116719230 (pole3)    03400 DNA repair and recombination proteins [BR:xhe03400]     116719230 (pole3) Enzymes [BR:xhe01000]  2. Transferases   2.7  Transferring phosphorus-containing groups    2.7.7  Nucleotidyltransferases     2.7.7.7  DNA-directed DNA polymerase      116719230 (pole3) DNA replication proteins [BR:xhe03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase epsilon complex     116719230 (pole3) Chromosome and associated proteins [BR:xhe03036]  Eukaryotic type   Chromatin remodeling factors    CHRAC complex     116719230 (pole3) DNA repair and recombination proteins [BR:xhe03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase epsilon complex       116719230 (pole3) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CBFD_NFYB_HMF Histone CENP-T_C SpoU_methylase CIS_TMP DUF4746 PPP4R2 Nop52 RNA_pol_3_Rpc31 DUF5427 RNA_pol_Rpc4 DDHD CDC45 Motif Other DBs NCBI-GeneID:  116719230 NCBI-ProteinID:  XP_032417606 LinkDB All DBs Position 4:763593..766603 Genome browser AA seq 150 aa AA seqDB search MAERPEDLNLPNAVITRIIKEALPDGVNVSKEARRAISQAASVFVLYATSCANNFAMKAK RKTLNAGDVLAAMEEMEFERFLEPLRDALEVYKKDQRGRKEVSEQKRRDKERKADSENEK SREEEEEEEEEQQRMEEEPEEEAEEEEEDN NT seq 453 nt NT seq  +upstreamnt  +downstreamnt atggcggagcggccagaggacctgaaccttcccaacgcggtgatcacccgcatcatcaag gaggcgctcccagatggggtgaacgtgtccaaagaggcccggcgcgccatctcccaggcg gccagcgtcttcgtgctgtatgcaacctcctgcgccaataactttgctatgaaggccaag aggaagacgctgaacgcaggagacgtgctggcggccatggaggagatggagttcgagcga ttcctggagccgctgcgggacgctctggaagtgtacaagaaagaccagagggggaggaag gaggtgagcgaacagaaacgcagagacaaggagaggaaggccgactccgagaacgagaag agcagagaggaagaggaggaggaagaggaggagcagcagcgcatggaggaggagcctgag gaggaagctgaggaagaggaggaggacaactga

DBGET integrated database retrieval system