Xiphophorus hellerii (green swordtail): 116729735 Help Entry 116729735         CDS       T07363                                  Symbol gnrh1 Name (RefSeq) progonadoliberin-1   KO K05252   gonadotropin-releasing hormone Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04080   Neuroactive ligand-receptor interaction xhe04081   Hormone signaling xhe04912   GnRH signaling pathway Brite KEGG Orthology (KO) [BR:xhe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04080 Neuroactive ligand-receptor interaction     116729735 (gnrh1)    04081 Hormone signaling     116729735 (gnrh1)  09150 Organismal Systems   09152 Endocrine system    04912 GnRH signaling pathway     116729735 (gnrh1)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xhe04052]     116729735 (gnrh1) Cytokines and neuropeptides [BR:xhe04052]  Neuropeptides   GPCR binding    116729735 (gnrh1) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  GnRH Motif Other DBs NCBI-GeneID:  116729735 NCBI-ProteinID:  XP_032434338 LinkDB All DBs Position 12:25676912..25678603 Genome browser AA seq 94 aa AA seqDB search MAVGTLTLWLLLVGTVLSLGSGQHWSFGLSPGGKRELDGFPNTLDSIYEGFAHMAAPCNV LGCAEESLPAKIYRMKGLLGSLSEREHGQQPFEK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggctgtcggaacgctgactctgtggctcctcctggtggggacggtgctgtcgctgggc agcggtcagcactggtcattcgggctgagcccaggcggaaagagggaactggatggcttc ccaaacacactggacagcatttatgaaggttttgctcacatggctgcgccttgcaacgtt ctgggctgtgcagaggagtcactgcctgccaaaatctacagaatgaaaggacttcttggg agcctgtctgagagggaacacggacaacaaccattcgaaaaatga

DBGET integrated database retrieval system