Xiphophorus hellerii (green swordtail): 116731134 Help Entry 116731134         CDS       T07363                                  Name (RefSeq) protein S100-A1-like   KO K17274   protein S100-A10 Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04382   Cornified envelope formation xhe05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xhe00001]  09150 Organismal Systems   09158 Development and regeneration    04382 Cornified envelope formation     116731134  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116731134  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xhe04147]     116731134 Exosome [BR:xhe04147]  Exosomal proteins   Exosomal proteins of microglial cells    116731134 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  S_100 EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 EH DEK_C Motif Other DBs NCBI-GeneID:  116731134 NCBI-ProteinID:  XP_032436554 LinkDB All DBs Position 13:complement(11950494..11952421) Genome browser AA seq 100 aa AA seqDB search MPSDLETAMELLIVVFHRYASADGRAGTLSRRELRQLMENELANFLKSQKDPGAIDKIMK DLDANGDGQVDFEEFVALVVGLSVACEQCYKMHKGLKSAK NT seq 303 nt NT seq  +upstreamnt  +downstreamnt atgccctctgacctggagacagccatggagctgctcattgtggtgttccaccgttacgcc tctgcggacggccgagcagggactctcagccggcgggagctcaggcagctgatggagaac gagctggctaacttccttaagtctcagaaggaccctggtgccatcgataagataatgaag gacctggacgccaatggtgacggccaggtggactttgaggagtttgttgctctggtggtt ggactgtctgttgcctgtgagcagtgctataagatgcacaaaggactgaagtcggcaaaa tag

DBGET integrated database retrieval system