Xiphophorus hellerii (green swordtail): 116733365 Help Entry 116733365         CDS       T07363                                  Name (RefSeq) permeability factor 2-like   KO K10030   interleukin 8 Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04060   Cytokine-cytokine receptor interaction xhe04218   Cellular senescence xhe04620   Toll-like receptor signaling pathway xhe04621   NOD-like receptor signaling pathway xhe04622   RIG-I-like receptor signaling pathway xhe05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xhe00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     116733365  09140 Cellular Processes   09143 Cell growth and death    04218 Cellular senescence     116733365  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     116733365    04621 NOD-like receptor signaling pathway     116733365    04622 RIG-I-like receptor signaling pathway     116733365  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116733365  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xhe04052]     116733365    00536 Glycosaminoglycan binding proteins [BR:xhe00536]     116733365 Cytokines and neuropeptides [BR:xhe04052]  Cytokines   Chemokines    116733365 Glycosaminoglycan binding proteins [BR:xhe00536]  Heparan sulfate / Heparin   Chemokines    116733365 SSDB OrthologParalogGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  116733365 NCBI-ProteinID:  XP_032440074 LinkDB All DBs Position 14:complement(10488348..10491031) Genome browser AA seq 104 aa AA seqDB search MKLCIVIVLAALLVLADGMPPINRDLNPHCRCLQVESRIIPAENLKSIKLVPEGPNCAET EVIAGLVSGEKVCLNPQSAWVKKLVQFVLERQTQKQKAAPKKTA NT seq 315 nt NT seq  +upstreamnt  +downstreamnt atgaagctctgcatcgtgattgtgctggcggccctgctggtgctcgctgacggaatgccg cccataaacagggacctcaacccacactgcaggtgcctgcaggtcgagtccaggatcatc cctgcggagaacctgaagagcatcaagctggtccccgaggggcccaactgcgccgaaaca gaagtcatagccggactggtgagcggggagaaggtgtgtctcaaccctcagtccgcctgg gtgaagaagctggtccagtttgtcctggagagacagacccagaagcagaaagccgctccc aagaagacggcatga

DBGET integrated database retrieval system