Xiphophorus hellerii (green swordtail): 116734025 Help Entry 116734025         CDS       T07363                                  Symbol hras Name (RefSeq) GTPase HRas   KO K02833   GTPase HRas Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe04010   MAPK signaling pathway xhe04012   ErbB signaling pathway xhe04068   FoxO signaling pathway xhe04137   Mitophagy - animal xhe04140   Autophagy - animal xhe04144   Endocytosis xhe04150   mTOR signaling pathway xhe04210   Apoptosis xhe04218   Cellular senescence xhe04370   VEGF signaling pathway xhe04371   Apelin signaling pathway xhe04510   Focal adhesion xhe04540   Gap junction xhe04625   C-type lectin receptor signaling pathway xhe04810   Regulation of actin cytoskeleton xhe04910   Insulin signaling pathway xhe04912   GnRH signaling pathway xhe04916   Melanogenesis xhe05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xhe00001]  09130 Environmental Information Processing   09132 Signal transduction    04010 MAPK signaling pathway     116734025 (hras)    04012 ErbB signaling pathway     116734025 (hras)    04370 VEGF signaling pathway     116734025 (hras)    04371 Apelin signaling pathway     116734025 (hras)    04068 FoxO signaling pathway     116734025 (hras)    04150 mTOR signaling pathway     116734025 (hras)  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     116734025 (hras)    04140 Autophagy - animal     116734025 (hras)    04137 Mitophagy - animal     116734025 (hras)   09143 Cell growth and death    04210 Apoptosis     116734025 (hras)    04218 Cellular senescence     116734025 (hras)   09144 Cellular community - eukaryotes    04510 Focal adhesion     116734025 (hras)    04540 Gap junction     116734025 (hras)   09142 Cell motility    04810 Regulation of actin cytoskeleton     116734025 (hras)  09150 Organismal Systems   09151 Immune system    04625 C-type lectin receptor signaling pathway     116734025 (hras)   09152 Endocrine system    04910 Insulin signaling pathway     116734025 (hras)    04912 GnRH signaling pathway     116734025 (hras)    04916 Melanogenesis     116734025 (hras)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     116734025 (hras)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xhe04131]     116734025 (hras)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xhe04147]     116734025 (hras)    04031 GTP-binding proteins [BR:xhe04031]     116734025 (hras) Membrane trafficking [BR:xhe04131]  Exocytosis   Small GTPases and associated proteins    Other small GTPases and associated proteins     116734025 (hras)  Endocytosis   Macropinocytosis    Ras GTPases     116734025 (hras) Exosome [BR:xhe04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    116734025 (hras)   Exosomal proteins of colorectal cancer cells    116734025 (hras) GTP-binding proteins [BR:xhe04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     116734025 (hras) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 Septin Ldh_1_N AAA_16 Motif Other DBs NCBI-GeneID:  116734025 NCBI-ProteinID:  XP_032441028 LinkDB All DBs Position 2:16068098..16088779 Genome browser AA seq 189 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHQYREQIKRVKDSDDVPMVLVGNKCDL PARTVDTRQAQELARSYGIPYIETSAKTRQGVEDAFYTLVREIRQHKLRKLNPPDESGQD CMSCRCVVS NT seq 570 nt NT seq  +upstreamnt  +downstreamnt atgacggagtataagctggtggtggtgggagctggaggtgtgggcaagagtgcgctcacc atccagctcatccagaaccactttgtggatgaatatgaccctactatagaggactcctac cggaagcaagtggtgatcgacggggagacatgcttgctggatatcctggacactgcaggt caggaggagtacagcgccatgagggatcagtatatgagaacaggagagggcttcctctgc gtttttgcaatcaacaacaccaagtcttttgaggacattcaccagtacagagaacagatc aagcgtgtgaaagactctgatgatgtacccatggtgcttgtgggaaacaaatgtgacctc ccagcacgcacagtggacacaaggcaagcccaggagcttgctcgctcctacggcatccct tacattgagacctcagcgaagacacgacaaggagtggaggatgcgttctacacactggtg agggaaataagacagcacaagctgaggaagctgaacccacctgatgaaagcggccaggac tgtatgagttgcagatgtgtggtatcgtga

DBGET integrated database retrieval system