Xiphophorus hellerii (green swordtail): 116735016 Help Entry 116735016         CDS       T07363                                  Symbol cenpx Name (RefSeq) centromere protein X   KO K15360   centromere protein X Organism xhe  Xiphophorus hellerii (green swordtail) Pathway xhe03460   Fanconi anemia pathway Brite KEGG Orthology (KO) [BR:xhe00001]  09120 Genetic Information Processing   09124 Replication and repair    03460 Fanconi anemia pathway     116735016 (cenpx)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03400 DNA repair and recombination proteins [BR:xhe03400]     116735016 (cenpx) DNA repair and recombination proteins [BR:xhe03400]  Eukaryotic type   DSBR (double strand breaks repair)    FA (Fanconi anemia) pathway     FA core complex binding factors      116735016 (cenpx) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  CENP-X Motif Other DBs NCBI-GeneID:  116735016 NCBI-ProteinID:  XP_032442499 LinkDB All DBs Position 16:11620813..11623477 Genome browser AA seq 81 aa AA seqDB search MAEKEEEVCFKKETVSKLLCSFFKEDKTRLGSDATLLMREMLKVFVQEAALRSLKQAEAE DCNQVEIEHFEKILPQLLLDF NT seq 246 nt NT seq  +upstreamnt  +downstreamnt atggcggagaaagaggaagaagtctgcttcaaaaaggaaaccgtgagcaaactcctgtgc agtttctttaaagaggacaaaaccagattaggcagtgatgctacgctactcatgagagaa atgctgaaagtgtttgtgcaagaggctgctttgagatcgctgaaacaagctgaagctgag gattgcaaccaagttgagattgagcattttgaaaagatcctgcctcagctgcttctggat ttctag

DBGET integrated database retrieval system