Xenorhabdus hominickii: A9255_07665 Help Entry A9255_07665       CDS       T04538                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xho  Xenorhabdus hominickii Pathway xho01100   Metabolic pathways xho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9255_07665    00074 Mycolic acid biosynthesis     A9255_07665   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9255_07665 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 ACP_SdgA_C Ribosomal_L12_N DUF5783 Ribosomal_L50 DUF5798 Motif Other DBs NCBI-ProteinID:  AOM40468 UniProt:  A0A2G0Q1C7 LinkDB All DBs Position complement(1582533..1582769) Genome browser AA seq 78 aa AA seqDB search MSTIDERVKKIIVEQLGVKEEEVVNTASFVDDLGADSLDTVELVMALEEEFDIEIPDEEA EKITTVQAAIDYVENAGK NT seq 237 nt NT seq  +upstreamnt  +downstreamnt atgagcactatcgacgaacgcgttaagaaaatcatcgttgaacaactgggtgttaaagag gaagaagttgtaaatacagcttcatttgttgatgacttgggcgctgattctcttgacaca gttgaactggtaatggctctggaagaagagttcgatatcgagatcccagacgaagaagct gagaaaatcactacagttcaggctgctattgactacgttgaaaacgcaggtaaataa

DBGET integrated database retrieval system