Xenorhabdus hominickii: A9255_17570 Help Entry A9255_17570       CDS       T04538                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xho  Xenorhabdus hominickii Pathway xho01100   Metabolic pathways xho01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xho00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     A9255_17570    00074 Mycolic acid biosynthesis     A9255_17570   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     A9255_17570 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Ribosomal_L50 DUF4809 Motif Other DBs NCBI-ProteinID:  AOM42203 UniProt:  A0ABN4S718 LinkDB All DBs Position complement(3852536..3852802) Genome browser AA seq 88 aa AA seqDB search MMEKHAIFQEVSQLLVQLFELSPEDITPESRLYEDLELDSIDAVDMVVHLQKKTGRKIKP EAFKSVRTVQDVVDAVEQLLQERVSQEQ NT seq 267 nt NT seq  +upstreamnt  +downstreamnt atcatggaaaagcacgcaatttttcaagaggtgtctcagttattggttcaactgttcgaa ctttctcctgaagatatcacgcccgaatcacgactctatgaagatctagaactcgatagt attgatgcggtagatatggttgtccatttgcagaaaaaaaccggacgcaaaatcaagccg gaagcattcaagtctgtccgtaccgttcaggacgttgtggatgcggtagaacagttgttg caagaacgagtgtcgcaagaacaataa

DBGET integrated database retrieval system