KEGG   Xanthomonas hortorum: XJ27_02605
Entry
XJ27_02605        CDS       T05082                                 
Name
(GenBank) sensory protein
  KO
K05770  translocator protein
Organism
xhr  Xanthomonas hortorum
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:xhr02000]
    XJ27_02605
Transporters [BR:xhr02000]
 Other transporters
  Others
   XJ27_02605
SSDB
Motif
Pfam: TspO_MBR ECF_trnsprt
Other DBs
NCBI-ProteinID: ASW44985
LinkDB
Position
624398..624898
AA seq 166 aa
MEMSMTKKSQWFGLLGWLVLCYLVAALGATASIEAASFYAELQRPAWAPPGWLFGPVWTV
LYGMMAVSAWLVWRRGGWNSTHGALSLFVLQLGLNGLWSWLFFAWHMGAWAFVDIVALWV
ALVLTIVAFAKWQRVAAWLLVPYLLWVSLAAALNYSVWQLNPQVLG
NT seq 501 nt   +upstreamnt  +downstreamnt
atggagatgtcgatgacgaagaaatcgcagtggtttggactgctggggtggttggtgctg
tgctatctggtcgctgccctgggagcgacggcgtcgatcgaggcggcgagcttctacgcc
gagttgcagcggccggcctgggcgccaccagggtggttgttcgggcccgtgtggacagtg
ttgtacggaatgatggcggtgtcggcgtggttggtctggcggcgcggtgggtggaacagt
acgcatggggcgctgagtctgttcgtgctgcagttggggttgaacgggttgtggagctgg
ttgttctttgcctggcacatgggcgcctgggcgtttgtcgatatcgtggcgctgtgggtg
gcgttggtgctgacgatcgtagcgttcgccaagtggcagcgggttgctgcgtggttgttg
gttccatatctgctatgggtaagtcttgcggcggcgttgaactattcggtgtggcagctc
aatcctcaggtgcttggctaa

DBGET integrated database retrieval system