Xanthomonas hortorum: XJ27_09585 Help Entry XJ27_09585        CDS       T05082                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xhr  Xanthomonas hortorum Pathway xhr01100   Metabolic pathways xhr01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xhr00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     XJ27_09585    00074 Mycolic acid biosynthesis     XJ27_09585   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     XJ27_09585 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF7080 DUF1896 Motif Other DBs NCBI-ProteinID:  ASW46177 LinkDB All DBs Position complement(2241246..2241485) Genome browser AA seq 79 aa AA seqDB search MSTIEERVKKIVVEQLGVKEEEVTTSASFVDDLGADSLDTVELVMALEEEFECEIPDEEA EKITSVQQAIDYVKAHVKS NT seq 240 nt NT seq  +upstreamnt  +downstreamnt atgagcaccatcgaagaacgcgtcaagaaaatcgtcgtcgaacaactcggcgtcaaggaa gaggaagtcaccaccagcgcatcgttcgtcgatgacctgggtgccgactcgctggacacc gtcgagctggtgatggcgctggaagaagagttcgagtgcgagatcccggacgaagaggct gaaaagatcacctcggtccagcaggcgatcgactacgtgaaggctcacgtcaagagctga

DBGET integrated database retrieval system