Xanthomonas hortorum: XJ27_18175 Help Entry XJ27_18175        CDS       T05082                                  Name (GenBank) serine kinase   KO K18375   type III secretion hrp pilus HrpE Organism xhr  Xanthomonas hortorum Module xhr_M00660   Xanthomonas spp. pathogenicity signature, T3SS and effectors Brite KEGG Orthology (KO) [BR:xhr00001]  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    02044 Secretion system [BR:xhr02044]     XJ27_18175 Secretion system [BR:xhr02044]  Type III secretion system   Type III secretion related proteins    XJ27_18175 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-ProteinID:  ASW47663 LinkDB All DBs Position complement(4199374..4199646) Genome browser AA seq 90 aa AA seqDB search MSDLPSIGPRFGQGVDLLRSDFSSRFDNYTSTKTSDNQIDSLMGGIGKNAAEQERMNNYL TAKKNELDFNVALNKFIGKAGDNAKQLVGQ NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgtcagatttaccatcgatagggccgcgattcggccagggcgtggatctgcttcgatca gacttttcaagcagatttgacaattacactagcactaagacctcggacaatcagattgat agtctgatgggtggcattggcaaaaatgccgcagaacaggagcgcatgaacaactacctg actgcgaagaagaacgaacttgacttcaacgtggcgctcaacaaattcatcggcaaggca ggcgacaacgcgaagcagctggttggccagtaa

DBGET integrated database retrieval system