Xanthomonas hortorum: XJ27_20120 Help Entry XJ27_20120        CDS       T05082                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xhr  Xanthomonas hortorum Pathway xhr00290   Valine, leucine and isoleucine biosynthesis xhr00650   Butanoate metabolism xhr00660   C5-Branched dibasic acid metabolism xhr00770   Pantothenate and CoA biosynthesis xhr01100   Metabolic pathways xhr01110   Biosynthesis of secondary metabolites xhr01210   2-Oxocarboxylic acid metabolism xhr01230   Biosynthesis of amino acids Module xhr_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xhr_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xhr00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     XJ27_20120    00660 C5-Branched dibasic acid metabolism     XJ27_20120   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     XJ27_20120   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     XJ27_20120 Enzymes [BR:xhr01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      XJ27_20120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  ASW47987 UniProt:  A0AA47EU72 LinkDB All DBs Position complement(4682058..4682315) Genome browser AA seq 85 aa AA seqDB search MRYRLDLVLKPAEGALVRVLGMTERRGFRPCAIQGAAAPDDAGRWHLQLDVDSTRPPETL RLQLEKVYDCESVVITALESVEAAA NT seq 258 nt NT seq  +upstreamnt  +downstreamnt atgcgttaccggcttgatctggtgctgaagccggccgaaggcgcgctggtgcgggtgctc ggcatgaccgagcgacgcggcttccgcccgtgcgccatccagggcgccgccgcgcccgac gatgccgggcgctggcatctgcaactggacgtggacagcacacgcccaccggaaacgctg cgcctgcagttggaaaaggtgtacgactgcgagtcggtggtgatcaccgcgctggaatcg gtcgaggctgcggcatga

DBGET integrated database retrieval system