KEGG   Xanthomonas hortorum: XJ27_21575
Entry
XJ27_21575        CDS       T05082                                 
Name
(GenBank) helicase
  KO
K03722  ATP-dependent DNA helicase DinG [EC:5.6.2.3]
Organism
xhr  Xanthomonas hortorum
Brite
KEGG Orthology (KO) [BR:xhr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:xhr03400]
    XJ27_21575
Enzymes [BR:xhr01000]
 5. Isomerases
  5.6  Isomerases altering macromolecular conformation
   5.6.2  Enzymes altering nucleic acid conformation
    5.6.2.3  DNA 5'-3' helicase
     XJ27_21575
DNA repair and recombination proteins [BR:xhr03400]
 Prokaryotic type
  Other factors with a suspected DNA repair function
   DNA helicases
    XJ27_21575
SSDB
Motif
Pfam: Helicase_C_2 DEAD ResIII DEAD_2
Other DBs
NCBI-ProteinID: ASW48237
LinkDB
Position
5049563..5051569
AA seq 668 aa
MSQLATASIEALSEGGALARQLDAFAPRAAQLRLTGAIAEAFEQRDVLLAEAGTGTGKTY
AYLVPVLLSGLKTIISTGTRALQDQLFHRDLPRVRAALGIGLRSALLKGRANYLCKYRTQ
QARGEPRFSTPEQVSQFHRIVAWSGRTQFGDMAEMEALPDDSPLLPLVTSTVDNCLGTEC
PFYSECFVVQARQRAQAADLVVVNHHLLLADLALKQEGFGEILPGAQAFVIDEAHQLPEL
AANFFGESFGMRPWQELARDCMVEARLVAGAQASLQEPILALDEALRGLRSGMEGLPPRG
TQWRALAKPQVREGFDAVLSSLARLGESLLPLREASPGFDGCSARAQEALARLSRWLGED
APVLDFAQELPDTVDNDVLWYELSPRGFRCQRTPLDVSGPLREHREKSHAAWVFTSATLA
VGGEFDHIAQRLGLSDPVTLLQPSPFDWARQALCYLPPHLPDPAARGFGTALIAALTPVL
EASNGRAFLLFASHRALREAAEALRGAPWPLFVQGEAPRATLLQRFRTSGNGVLLGSASF
REGVDVVGDALSVVVIDKLPFAAPDDPVFEARLDAIRREGGNPFRDEQLPQAVIALKQGV
GRLIRSETDRGVLVLCDPRLLNKGYGRTFMNSLPPFARTREIGDVRAFFGVAEPVGDNGV
HALPFGDA
NT seq 2007 nt   +upstreamnt  +downstreamnt
atgtcccaacttgccactgccagcatcgaggcgctcagcgagggcggggcgcttgcgcgt
cagctcgacgcatttgcgccgcgtgccgcgcagttgcgcctgaccggcgccatcgccgag
gcgttcgagcagcgcgatgtgctgttggccgaggccggcaccgggaccggcaagacctac
gcctatctggtgccagtgctgctgtccgggctcaagaccatcatctcgaccggcacccgc
gcgctgcaggaccagttgttccatcgcgatctgccgcgcgtacgcgccgcgttgggcatc
ggcctgcgcagcgcactgctgaaagggcgcgccaattatctgtgcaagtaccgcacccag
caggcgcgcggcgaaccgcgtttttctacgcccgaacaggtctcgcagttccatcgcatc
gttgcctggagcgggcgtacccagttcggcgacatggccgagatggaagccctaccggac
gactcgccactgctgccgctggtgacttccacggtcgacaactgcctgggcaccgaatgc
ccgttctacagcgagtgttttgtggtgcaggcgcgtcagcgcgcgcaggccgccgacctg
gtggtggtcaatcatcatctgctgctggccgatctggcgctcaagcaggaaggcttcggc
gagatcctgcccggcgcgcaggccttcgtcatcgacgaagcgcatcagctgccggaactg
gcggcgaatttctttggcgaaagtttcggcatgcggccctggcaggagctggcccgcgat
tgcatggtcgaagcgcggctggtggccggcgcgcaggccagcctgcaggaaccgattctc
gccttggacgaagcgttgcgcggcctgcgctcaggcatggaaggcctgccgccacgcggc
acccaatggcgcgcgctggccaagccgcaggtgcgcgagggcttcgatgcggtgctgtcg
tcgctggcacggttgggcgagtccttgctgccgttgcgcgaggcatcgcccgggttcgac
ggctgctctgcacgcgcgcaggaagcgctcgcgcggctgtcgcgctggctgggcgaagac
gcgccggtgctggattttgcgcaggaattgccggacaccgtcgacaacgatgtgctgtgg
tacgagctgagtccgcgcggtttccgctgccaacgcacgccgctggatgtctccggcccg
ctgcgcgaacaccgcgaaaaatcgcacgcggcgtgggtgttcacctcggccacgttggcg
gtgggcggcgagttcgaccacatcgcgcagcgcctgggcttgagcgatccggtgaccttg
ctgcaacccagtcccttcgattgggcgcgccaggcgctgtgctatctgccgccgcatctg
cccgatccggcggcgcgcggcttcggcacggcgctgatcgccgcattgacgccggtactg
gaagcctccaacggacgcgcattcctgttgttcgcctcgcaccgcgcgctgcgcgaagcc
gccgaggcattgcgcggtgcgccgtggcccttgttcgtgcaaggcgaagcgccacgcgcc
acgttactgcagcgtttccgcacttccggcaacggtgtgctgctggggtctgccagcttc
cgcgagggcgtggacgtggtcggcgatgccttgagcgtggtggtgatcgataagctgccg
tttgccgcgcccgacgacccggtcttcgaagcgcgcctggatgcgatccgccgcgagggc
ggcaacccgttccgcgacgagcaattgccgcaggcggtgattgcgctgaagcagggcgtg
ggccggttgatccgcagcgagaccgatcgcggcgtgctggtgctgtgcgacccgcggctg
ttgaacaaaggctacggccgcaccttcatgaactcgctgccgccgtttgcgcgcacccgc
gagatcggcgatgtgcgcgcgttttttggcgtcgccgagccggtgggcgacaatggcgtg
cacgcgttgccgttcggcgacgcgtga

DBGET integrated database retrieval system