Xanthomonas hyacinthi: FZ025_01675 Help Entry FZ025_01675       CDS       T06345                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xhy  Xanthomonas hyacinthi Pathway xhy00998   Biosynthesis of various antibiotics xhy01100   Metabolic pathways xhy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xhy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FZ025_01675    00074 Mycolic acid biosynthesis     FZ025_01675   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FZ025_01675 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 EACC1 PGM_PMM_II Motif Other DBs NCBI-ProteinID:  QGY75439 LinkDB All DBs Position 347171..347446 Genome browser AA seq 91 aa AA seqDB search MTPSIETQIHSIVAKHGEIDPAGLTADTKLQDLGVDSLEAIEILFDIEEHFDITFPQRDP NLDDGSLGKLAEAVQQALDAKAAAAALAPAH NT seq 276 nt NT seq  +upstreamnt  +downstreamnt atgaccccgtctatcgagacacagatccacagcatcgtcgccaagcacggcgagatcgat cccgccggcctgaccgccgacaccaaactgcaggacctgggcgtggattcgctcgaggcg atcgaaatcctgttcgacatcgaggagcacttcgacatcaccttcccgcagcgcgatccg aacctggacgacggttcgctgggcaagctggccgaggcggtgcagcaagcgctggacgcc aaggccgccgccgcggcgctggcaccggcgcactga

DBGET integrated database retrieval system