Xanthomonas hyacinthi: FZ025_10120 Help Entry FZ025_10120       CDS       T06345                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xhy  Xanthomonas hyacinthi Pathway xhy00998   Biosynthesis of various antibiotics xhy01100   Metabolic pathways xhy01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xhy00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     FZ025_10120    00074 Mycolic acid biosynthesis     FZ025_10120   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     FZ025_10120 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding Motif Other DBs NCBI-ProteinID:  QGY76981 LinkDB All DBs Position 2230655..2230924 Genome browser AA seq 89 aa AA seqDB search MSSQTAAERELAELLVESLNLEDVQPGDIDPEAPLFNTGLGLDSIDALELALAINKRYGF QLRSDNDENRRIFASLRALSAHVEANKTS NT seq 270 nt NT seq  +upstreamnt  +downstreamnt atgtcttcgcaaaccgccgctgaacgtgaactggccgagctgctggtcgagagcctgaac ctggaagacgtgcagcccggcgacatcgatccggaggcgccgctgttcaataccgggctg ggactggactcgatcgacgcgctggaactggcgctggcgatcaacaagcgctatggcttc cagctgcgctcggacaacgacgagaaccgccgcatcttcgcctcgctgcgcgcactgtcg gcgcatgtcgaagccaacaagaccagctga

DBGET integrated database retrieval system