Xanthomonas hyacinthi: FZ025_12905 Help Entry FZ025_12905       CDS       T06345                                  Name (GenBank) acetolactate synthase   KO K11258   acetolactate synthase II small subunit [EC:2.2.1.6] Organism xhy  Xanthomonas hyacinthi Pathway xhy00290   Valine, leucine and isoleucine biosynthesis xhy00650   Butanoate metabolism xhy00660   C5-Branched dibasic acid metabolism xhy00770   Pantothenate and CoA biosynthesis xhy01100   Metabolic pathways xhy01110   Biosynthesis of secondary metabolites xhy01210   2-Oxocarboxylic acid metabolism xhy01230   Biosynthesis of amino acids Module xhy_M00019   Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine xhy_M00570   Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine Brite KEGG Orthology (KO) [BR:xhy00001]  09100 Metabolism   09101 Carbohydrate metabolism    00650 Butanoate metabolism     FZ025_12905    00660 C5-Branched dibasic acid metabolism     FZ025_12905   09105 Amino acid metabolism    00290 Valine, leucine and isoleucine biosynthesis     FZ025_12905   09108 Metabolism of cofactors and vitamins    00770 Pantothenate and CoA biosynthesis     FZ025_12905 Enzymes [BR:xhy01000]  2. Transferases   2.2  Transferring aldehyde or ketonic groups    2.2.1  Transketolases and transaldolases     2.2.1.6  acetolactate synthase      FZ025_12905 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ACT_5 Motif Other DBs NCBI-ProteinID:  QGY77490 LinkDB All DBs Position complement(2917746..2917994) Genome browser AA seq 82 aa AA seqDB search MRYQLDLVLKPAEGALLRAIGMAERRGFAPLSIAGAPVADDAGRWHLQMVVDGNRPGESL RLQMEKVYDCESVRVTALDVVP NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atgcgctaccagcttgacctggtgctgaagccggccgaaggcgcgctgctgcgcgcgatc ggcatggccgagcggcgcggcttcgcgccgctgtcgatcgccggcgcgccggtggccgac gacgccggccgctggcacctgcagatggtcgtggacggcaatcgccccggcgagagcctg cgcctgcagatggaaaaggtgtacgactgcgagtcggtgcgggtcactgcgctggacgtg gtgccatga

DBGET integrated database retrieval system