Xanthomonas hyacinthi: FZ025_13155 Help Entry FZ025_13155       CDS       T06345                                  Name (GenBank) TIGR02449 family protein   KO K09892   cell division protein ZapB Organism xhy  Xanthomonas hyacinthi Brite KEGG Orthology (KO) [BR:xhy00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xhy03036]     FZ025_13155 Chromosome and associated proteins [BR:xhy03036]  Prokaryotic type   Chromosome partitioning proteins    Divisome proteins     FZ025_13155 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  ZapB Herpes_BLRF2 Taxilin bZIP_1 COG6_N Wtap GAS Dynamitin Laminin_I FlgN FAZ1_C YabA Stathmin SKA2 DUF7603 Mod_r Shugoshin_N bZIP_2 DUF7491 DUF3450 MctB DUF2203 FapA TMPIT CATRA-C Motif Other DBs NCBI-ProteinID:  QGY77538 LinkDB All DBs Position complement(2985087..2985308) Genome browser AA seq 73 aa AA seqDB search MDTPDALAQLRTLAARVETLVERCQRLTDENRSLRQQQEQLIGERSQLLTKNEQARSRVE AMITRLKSLEQHT NT seq 222 nt NT seq  +upstreamnt  +downstreamnt atggacacacccgacgccctcgcccagctccgcaccctcgccgcacgcgtggaaacgctg gtcgagcgctgccagcgcctcaccgacgagaaccgcagcctgcgccagcagcaggaacag ttgatcggcgagcgctcgcagctgctgaccaagaacgagcaggcgcgctcgcgggtcgaa gcgatgatcacccggctcaagtcgctggagcagcacacgtga

DBGET integrated database retrieval system