Xanthomonas indica: Q7W82_07900 Help Entry Q7W82_07900       CDS       T10539                                  Name (GenBank) HU family DNA-binding protein   KO K03530   DNA-binding protein HU-beta Organism xin  Xanthomonas indica Brite KEGG Orthology (KO) [BR:xin00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:xin03032]     Q7W82_07900    03036 Chromosome and associated proteins [BR:xin03036]     Q7W82_07900    03400 DNA repair and recombination proteins [BR:xin03400]     Q7W82_07900 DNA replication proteins [BR:xin03032]  Prokaryotic type   DNA Replication Initiation Factors    Initiation factors (bacterial)     Q7W82_07900 Chromosome and associated proteins [BR:xin03036]  Prokaryotic type   Nucleoid associated proteins    HU (heat unstable protein)     Q7W82_07900 DNA repair and recombination proteins [BR:xin03400]  Prokaryotic type   DSBR (double strand breaks repair)    NHEJ (non-homologous end-joining)     SHIIR (short-homology-independent illegitimate recombination)      Supressor       Q7W82_07900 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Bac_DNA_binding HU-HIG HU-CCDC81_bac_2 HU-CCDC81_euk_2 HU-CCDC81_euk_1 Phage_sheath_domII HU-DNA_bdg Arteri_nsp7a Lmo2446-like_N Motif Other DBs NCBI-ProteinID:  XCI82059 UniProt:  A0AAU8I9F2 LinkDB All DBs Position 1819857..1820129 Genome browser AA seq 90 aa AA seqDB search MNKAELNDAIAAAADISKAEAGRAIDAFVSEVTKALKKGDSVTLVGFGTFQVRDRAERTG RNPKTGDSIKIAASKNPTFKAGKALKDAVN NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaataaagccgaactgaacgacgcgatcgccgctgccgccgatatttccaaggccgaa gccggtcgtgccatcgacgccttcgtgtcggaagtgaccaaggccctgaagaagggcgac agcgtcacgctcgtgggcttcggcaccttccaggtgcgcgaccgtgccgagcgcaccggc cgcaacccgaagaccggcgactccatcaagatcgccgcgtcgaagaatccgacgttcaag gctggtaaagcgctgaaggatgccgtaaactaa

DBGET integrated database retrieval system