Xanthomonas indica: Q7W82_11635 Help Entry Q7W82_11635       CDS       T10539                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism xin  Xanthomonas indica Pathway xin01100   Metabolic pathways xin01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:xin00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     Q7W82_11635    00074 Mycolic acid biosynthesis     Q7W82_11635   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     Q7W82_11635 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding DUF7080 PP-binding_2 DUF4108 Motif Other DBs NCBI-ProteinID:  XCI78951 UniProt:  A0AAU8I162 LinkDB All DBs Position complement(2689534..2689806) Genome browser AA seq 90 aa AA seqDB search MTPSIESQIHSIVAKHGEIDPARLTPDAKLQDLGVDSLEAIEILFDIEEHFDITFPQRDP NLDDGSLGKLVQAVEDALAAKAASAAQPAH NT seq 273 nt NT seq  +upstreamnt  +downstreamnt atgaccccgtccatcgagtcgcaaatccacagcatcgtcgccaagcatggcgagatcgac ccggcacgcctgacccccgatgccaagctgcaggacctgggcgtggattcgctcgaggcc atcgaaatcctgttcgacatcgaggaacacttcgacatcaccttcccgcagcgcgacccg aacctggacgacggttcgctcggcaagctggtgcaggcggtcgaggacgcgctggcagcc aaggcggccagcgcggcgcaaccggcgcactga

DBGET integrated database retrieval system