Xenopus laevis (African clawed frog): 100381060 Help Entry 100381060         CDS       T01010                                  Symbol ccl5.L Name (RefSeq) C-C motif chemokine 5   KO K12499   C-C motif chemokine 5 Organism xla  Xenopus laevis (African clawed frog) Pathway xla04060   Cytokine-cytokine receptor interaction xla04620   Toll-like receptor signaling pathway xla04621   NOD-like receptor signaling pathway xla04623   Cytosolic DNA-sensing pathway xla05168   Herpes simplex virus 1 infection Brite KEGG Orthology (KO) [BR:xla00001]  09130 Environmental Information Processing   09133 Signaling molecules and interaction    04060 Cytokine-cytokine receptor interaction     100381060 (ccl5.L)  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     100381060 (ccl5.L)    04621 NOD-like receptor signaling pathway     100381060 (ccl5.L)    04623 Cytosolic DNA-sensing pathway     100381060 (ccl5.L)  09160 Human Diseases   09172 Infectious disease: viral    05168 Herpes simplex virus 1 infection     100381060 (ccl5.L)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xla04052]     100381060 (ccl5.L)    00536 Glycosaminoglycan binding proteins [BR:xla00536]     100381060 (ccl5.L) Cytokines and neuropeptides [BR:xla04052]  Cytokines   Chemokines    100381060 (ccl5.L) Glycosaminoglycan binding proteins [BR:xla00536]  Heparan sulfate / Heparin   Chemokines    100381060 (ccl5.L) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 CXCL16 DUF3666 Motif Other DBs NCBI-GeneID:  100381060 NCBI-ProteinID:  XP_018101813 Xenbase:  XB-GENE-1027621 UniProt:  A0A1L8HDW4 A0A974HXY2 LinkDB All DBs Position 2L:50186865..50195329 Genome browser AA seq 93 aa AA seqDB search MKAALITLTVFLFVAFYNEAESAPVGSDVVSCCFDFMKKAVPTRHMADYFYTSSRCSQFA VVLVTRKNRKICANPEDEWVKNIINALEMPEAV NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgaaggcagcactgatcactcttacagtttttctatttgtggctttttataatgaagct gagtcggcaccagttggttcagatgtcgtctcctgctgttttgatttcatgaagaaggca gtcccaaccagacacatggcagattacttctacaccagcagccgctgctctcaatttgca gttgttcttgtcacccggaagaatcggaaaatatgtgcaaatccagaagatgaatgggtc aagaatatcattaatgccctggagatgcctgaagcagtatag

DBGET integrated database retrieval system