Xenopus laevis (African clawed frog): 108697792 Help Entry 108697792         CDS       T01010                                  Symbol kras.S Name (RefSeq) GTPase HRas   KO K07827   GTPase KRas Organism xla  Xenopus laevis (African clawed frog) Pathway xla04010   MAPK signaling pathway xla04012   ErbB signaling pathway xla04068   FoxO signaling pathway xla04137   Mitophagy - animal xla04140   Autophagy - animal xla04150   mTOR signaling pathway xla04210   Apoptosis xla04218   Cellular senescence xla04370   VEGF signaling pathway xla04371   Apelin signaling pathway xla04540   Gap junction xla04625   C-type lectin receptor signaling pathway xla04810   Regulation of actin cytoskeleton xla04910   Insulin signaling pathway xla04912   GnRH signaling pathway xla04914   Progesterone-mediated oocyte maturation xla04916   Melanogenesis Brite KEGG Orthology (KO) [BR:xla00001]  09130 Environmental Information Processing   09132 Signal transduction    04068 FoxO signaling pathway     108697792 (kras.S)    04150 mTOR signaling pathway     108697792 (kras.S)  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108697792 (kras.S)    04137 Mitophagy - animal     108697792 (kras.S)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     108697792 (kras.S)   09183 Protein families: signaling and cellular processes    04031 GTP-binding proteins [BR:xla04031]     108697792 (kras.S) Membrane trafficking [BR:xla04131]  Endocytosis   Macropinocytosis    Ras GTPases     108697792 (kras.S) GTP-binding proteins [BR:xla04031]  Small (monomeric) G-proteins   Ras Family    Ras [OT]     108697792 (kras.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf GTP_EFTU MMR_HSR1 RsgA_GTPase FeoB_N ATP_bind_1 G1_gp67_C Septin ParA Motif Other DBs NCBI-GeneID:  108697792 NCBI-ProteinID:  XP_018083670 Xenbase:  XB-GENE-6252869 UniProt:  A0A1L8FH28 A0A974HAI4 LinkDB All DBs Position 7S:complement(98540328..98550209) Genome browser AA seq 186 aa AA seqDB search MTEYKLVVVGAGGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTAG QEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDVHHYREQINRVKDSDDVPMVLVGNKCDL PSRTVDTKQAQELAKSYGIPFIETSAKTRQGVEDAFYTLVREIRKHKEKISNGKKKKSSK RKCAIL NT seq 561 nt NT seq  +upstreamnt  +downstreamnt atgaccgagtacaaactagtggtggttggtgctgggggcgtagggaagagcgctcttaca atccagctcattcagaaccattttgtggacgagtatgatcctaccattgaggactcgtat agaaagcaggtggtgatagacggggaaacttgcctcctagacatattggatactgcgggg caagaggaatacagtgccatgagggatcagtacatgcgcacgggagaagggtttctctgt gtctttgctattaataacacaaagtctttcgaggacgtccatcattacagggaacagatt aacagagtaaaagattccgatgatgttcccatggtgttagttggtaacaaatgtgatctc ccatcccggactgtggacacaaagcaagcacaggaactggcaaagagctacggcatacct ttcatagagacctctgccaaaactagacagggagtcgaagatgccttctataccctagtc cgtgaaatccgcaagcacaaagagaagatcagcaatgggaaaaagaagaagtcctccaag agaaagtgtgccattctttaa

DBGET integrated database retrieval system