Xenopus laevis (African clawed frog): 108700004 Help Entry 108700004         CDS       T01010                                  Symbol MGC75872.S Name (RefSeq) ras-related protein Rab-7a   KO K07897   Ras-related protein Rab-7A Organism xla  Xenopus laevis (African clawed frog) Pathway xla04137   Mitophagy - animal xla04140   Autophagy - animal xla04144   Endocytosis xla04145   Phagosome xla04148   Efferocytosis xla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xla00001]  09140 Cellular Processes   09141 Transport and catabolism    04144 Endocytosis     108700004 (MGC75872.S)    04145 Phagosome     108700004 (MGC75872.S)    04140 Autophagy - animal     108700004 (MGC75872.S)    04137 Mitophagy - animal     108700004 (MGC75872.S)    04148 Efferocytosis     108700004 (MGC75872.S)  09160 Human Diseases   09171 Infectious disease: bacterial    05132 Salmonella infection     108700004 (MGC75872.S)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:xla04131]     108700004 (MGC75872.S)   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     108700004 (MGC75872.S)    04031 GTP-binding proteins [BR:xla04031]     108700004 (MGC75872.S) Membrane trafficking [BR:xla04131]  Endosome - Lysosome transport   Rab GTPases and associated proteins    Rab GTPases     108700004 (MGC75872.S) Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108700004 (MGC75872.S)   Exosomal proteins of other body fluids (saliva and urine)    108700004 (MGC75872.S)   Exosomal proteins of colorectal cancer cells    108700004 (MGC75872.S)   Exosomal proteins of bladder cancer cells    108700004 (MGC75872.S) GTP-binding proteins [BR:xla04031]  Small (monomeric) G-proteins   Rab Family    Rab7/9 [OT]     108700004 (MGC75872.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Ras Roc Arf Gtr1_RagA MMR_HSR1 G-alpha GTP_EFTU AAA_29 cobW AAA_7 RsgA_GTPase FeoB_N AAA_16 GIY_YIG_2 DAP3 AAA_22 MCM AAA_lid_7 CoaE Ploopntkinase3 Motif Other DBs NCBI-GeneID:  108700004 NCBI-ProteinID:  XP_018088317 Xenbase:  XB-GENE-6489283 UniProt:  A0A1L8F1U3 A0A974C3Z9 LinkDB All DBs Position 8S:37956658..37975233 Genome browser AA seq 199 aa AA seqDB search MFHRKHIKLLLIGNAGSGKSALMNQYVNCRFTNYYRATIGADFFTKELRVNDKFVTVQIW DTAGTERFQSLGAALYRGTDCCLLVFDVTSPKSFHALDNWHREFLVQADPISPGSFLFVV IGNKTDLQERQVSPREAEEWCKMFSARYFETSAKEASNVEEAFLEAIKLALNYHQEPDQN WETKVVNLSPPSNSKKCDC NT seq 600 nt NT seq  +upstreamnt  +downstreamnt atgttccacaggaagcacatcaagcttcttctcattgggaatgcaggatcaggaaagtcg gcactgatgaaccagtatgtcaactgtcggtttaccaactactacagagcgactatcggc gcagatttcttcacgaaggagttacgggttaatgataagtttgtgacagtgcagatatgg gacacagcgggcacggagcgcttccagtcattgggtgctgctctctatagaggcacagac tgttgcctgttggtgtttgacgtgacctcccctaaatccttccatgctctggataactgg cacagagagttcctggtacaagcggatcccatatctcctggaagcttcctgttcgtggtg atcggtaacaaaacagacctacaggagcggcaggtttcaccacgggaggcagaggaatgg tgtaaaatgttcagtgcaagatactttgaaaccagcgctaaggaagcaagcaacgtagag gaggcattcctggaagccatcaaattagccttaaactatcaccaggagcctgaccagaac tgggagaccaaggtagtgaacttgtctcctccgagcaatagcaagaaatgtgactgttag

DBGET integrated database retrieval system