Xenopus laevis (African clawed frog): 108704300 Help Entry 108704300         CDS       T01010                                  Name (RefSeq) histone H2A type 1-like   KO K11251   histone H2A Organism xla  Xenopus laevis (African clawed frog) Pathway xla03082   ATP-dependent chromatin remodeling xla04217   Necroptosis Brite KEGG Orthology (KO) [BR:xla00001]  09120 Genetic Information Processing   09126 Chromosome    03082 ATP-dependent chromatin remodeling     108704300  09140 Cellular Processes   09143 Cell growth and death    04217 Necroptosis     108704300  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xla03036]     108704300   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     108704300 Chromosome and associated proteins [BR:xla03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108704300 Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108704300 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone_H2A_C Histone CBFD_NFYB_HMF Motif Other DBs NCBI-GeneID:  108704300 NCBI-ProteinID:  XP_018096298 UniProt:  A0A8J0U729 LinkDB All DBs Position 9_10S:complement(114099396..114099980) Genome browser AA seq 129 aa AA seqDB search MSGRGKQGGKTRAKAKTRSSRAGLQFPVGRVHRLLRKGNYAERVGAGAPVYLAAVLEYLT AEILELAGNAARDNKKTRIIPRHLQLAVRNDEELNKLLGGVTIAQGGVLPNIQSVLLPKK TESKPAKSK NT seq 390 nt NT seq  +upstreamnt  +downstreamnt atgtctggaagaggcaaacagggtggcaagactcgcgctaaggcaaagactcgctcatct cgggccgggctgcagtttccagtcggccgtgttcacaggctcttgaggaagggcaattat gccgagcgggtgggagccggagctccggtctatctggccgcagtgctcgaatacctgacc gctgagatcctggagttggccggcaacgctgcccgggataacaagaagacccgcatcatc cccaggcacctgcagctcgctgtgcgcaacgatgaggagctcaacaaactgctcggagga gtcactatcgctcagggcggggtcctgcccaacatccagtccgtgctgctgcccaagaaa acagagtccaaaccggccaagagcaagtga

DBGET integrated database retrieval system