Xenopus laevis (African clawed frog): 108705274 Help Entry 108705274         CDS       T01010                                  Name (RefSeq) histone H2B 1.1-like   KO K11252   histone H2B Organism xla  Xenopus laevis (African clawed frog) Brite KEGG Orthology (KO) [BR:xla00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xla03036]     108705274   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     108705274 Chromosome and associated proteins [BR:xla03036]  Eukaryotic type   Nucleosome assembly factors    Histones     108705274 Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)    108705274 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Histone CBFD_NFYB_HMF TFIID_20kDa YscO-like CENP-T_C Motif Other DBs NCBI-GeneID:  108705274 NCBI-ProteinID:  XP_018097578 UniProt:  A0A310U368 A0AA97PYP1 LinkDB All DBs Position 9_10S:complement(113271115..113271459) Genome browser AA seq 94 aa AA seqDB search MDVEANRLFVYKVLKQVHPDTGISSKAMSIMNSFVNDVFERIAGEASRLAHYNKRSTITS REIQTAVRLLLPGELAKHAVSEGTKAVTKYTSAK NT seq 285 nt NT seq  +upstreamnt  +downstreamnt atggacgtggaggcaaatcgactttttgtgtacaaggtgctgaagcaggtgcaccccgat accggcatctcttccaaggccatgagcatcatgaactcctttgtcaacgatgtgtttgag cgcatcgcaggggaagcctcccgcctggctcattacaacaagcgctccaccatcacctcc cgggagatccagaccgcggtccgcctgctactgcctggggagctggccaagcacgccgtg tccgagggcaccaaggctgtcaccaagtacaccagcgccaagtaa

DBGET integrated database retrieval system