Xenopus laevis (African clawed frog): 108705708 Help Entry 108705708         CDS       T01010                                  Name (RefSeq) elongin-C   KO K03872   elongin-C Organism xla  Xenopus laevis (African clawed frog) Pathway xla04120   Ubiquitin mediated proteolysis Brite KEGG Orthology (KO) [BR:xla00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04120 Ubiquitin mediated proteolysis     108705708  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04121 Ubiquitin system [BR:xla04121]     108705708    03400 DNA repair and recombination proteins [BR:xla03400]     108705708 Ubiquitin system [BR:xla04121]  Ubiquitin ligases (E3)   Multi subunit type E3    Cul2 complex     Adoptor protein      108705708    Cul5 complex      108705708 DNA repair and recombination proteins [BR:xla03400]  Eukaryotic type   SSBR (single strand breaks repair)    NER (nucleotide excision repair)     Other NER factors      108705708 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Motif Other DBs NCBI-GeneID:  108705708 NCBI-ProteinID:  XP_018098053 UniProt:  A0A8J0U7P4 LinkDB All DBs Position 6L:110853735..110858021 Genome browser AA seq 112 aa AA seqDB search MDGEEKTYGGCEGPDAMYVKLISSDGHEFIVKREHALKSGTIKAMLSGPGQFAENETNEV NFREIPSHVLSKVCMYFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC NT seq 339 nt NT seq  +upstreamnt  +downstreamnt atggatggtgaagagaaaacatatggtggctgtgagggtcctgatgcaatgtatgtaaaa ctgatttcatctgatggccatgaatttattgttaaaagggaacatgctttgaaatcagga acaataaaggccatgttaagtggtccaggacagtttgctgaaaatgaaaccaatgaagtg aatttccgagagattccctcccatgttctatctaaagtctgcatgtattttacctacaag gttcgttacacaaacagctccacagaaatcccagaatttcccattgcgccagagatcgcg ctggaactgctgatggcggcaaatttcctagactgttaa

DBGET integrated database retrieval system