Xenopus laevis (African clawed frog): 108706768 Help Entry 108706768         CDS       T01010                                  Symbol cxcl2.S Name (RefSeq) growth-regulated alpha protein   KO K10030   interleukin 8 Organism xla  Xenopus laevis (African clawed frog) Pathway xla04060   Cytokine-cytokine receptor interaction xla04218   Cellular senescence xla04620   Toll-like receptor signaling pathway xla04621   NOD-like receptor signaling pathway xla04622   RIG-I-like receptor signaling pathway xla05132   Salmonella infection Brite KEGG Orthology (KO) [BR:xla00001]  09150 Organismal Systems   09151 Immune system    04620 Toll-like receptor signaling pathway     108706768 (cxcl2.S)  09180 Brite Hierarchies   09183 Protein families: signaling and cellular processes    04052 Cytokines and neuropeptides [BR:xla04052]     108706768 (cxcl2.S)    00536 Glycosaminoglycan binding proteins [BR:xla00536]     108706768 (cxcl2.S) Cytokines and neuropeptides [BR:xla04052]  Cytokines   Chemokines    108706768 (cxcl2.S) Glycosaminoglycan binding proteins [BR:xla00536]  Heparan sulfate / Heparin   Chemokines    108706768 (cxcl2.S) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  IL8 Motif Other DBs NCBI-GeneID:  108706768 NCBI-ProteinID:  XP_018098943 Xenbase:  XB-GENE-17331118 UniProt:  A0A1L8HMG8 A0A974DSH5 LinkDB All DBs Position 1S:complement(69184485..69199113) Genome browser AA seq 101 aa AA seqDB search MQCQINSLYIIGLILLLSHCLPASYGGSAVRELRCQCINTVSTAFHKKHIRSLEVYPKGP HCARVEVIVTLRNGVQHCLDPDTKWLTSVVKKILRRNSQKK NT seq 306 nt NT seq  +upstreamnt  +downstreamnt atgcagtgccagataaattcactgtacattattggactcattctgcttttatctcattgc cttcctgcatcatatggaggctcagcagtgagggagctgcgttgccaatgtataaatacc gtatcaaccgcctttcacaaaaaacacattcgttccctggaggtttatccaaaaggtcct cattgtgccagggtggaagtaattgtgacattgcgcaatggagttcagcactgtttagat ccagacacaaagtggttaacatctgttgtcaaaaagattctcagaaggaattcacagaag aaatga

DBGET integrated database retrieval system