Xenopus laevis (African clawed frog): 108707655 Help Entry 108707655         CDS       T01010                                  Name (RefSeq) cystatin-A   KO K13907   cystatin-A/B Organism xla  Xenopus laevis (African clawed frog) Brite KEGG Orthology (KO) [BR:xla00001]  09180 Brite Hierarchies   09181 Protein families: metabolism    01002 Peptidases and inhibitors [BR:xla01002]     108707655   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     108707655 Peptidases and inhibitors [BR:xla01002]  Peptidase inhibitors   Family I25: cystatin family    108707655 Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of other body fluids (saliva and urine)    108707655 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Other DBs NCBI-GeneID:  108707655 NCBI-ProteinID:  XP_018101148 UniProt:  A0A1L8HC15 A0A974HX67 LinkDB All DBs Position 2L:complement(3103410..3107166) Genome browser AA seq 93 aa AA seqDB search MSEWSETEPATPDIQDMIDELKPELERLSGTSFDHLHAVSYRMKHGSDAHTYLIKAHAPP NEFIHISLSLHGSHREVAPPQTGKTEDDPLEPY NT seq 282 nt NT seq  +upstreamnt  +downstreamnt atgtctgagtggagcgaaactgaaccagcgacccctgatatacaggacatgatcgatgag ctcaaaccagaattagagcgtctgagtggcacaagttttgatcatttacacgcggtgtcc tatagaatgaagcacggcagcgacgcacacacatatctcattaaggcacacgctccccct aatgagtttatccacatcagcctttccctgcacggaagtcaccgagaagttgcaccacca caaacaggtaaaactgaggacgatccactggagccttattaa

DBGET integrated database retrieval system