KEGG   Xenopus laevis (African clawed frog): 108707880
Entry
108707880         CDS       T01010                                 
Name
(RefSeq) melanocortin-2 receptor accessory protein 2A
  KO
K22398  melanocortin 2 receptor accessory protein
Organism
xla  Xenopus laevis (African clawed frog)
SSDB
Motif
Pfam: MRAP HemY_N DUF6097 Myc_target_1 OAD_gamma EVC2_like DUF2207 LapA_dom Baculo_11_kDa Mid2 EphA2_TM
Other DBs
NCBI-GeneID: 108707880
NCBI-ProteinID: XP_018101429
UniProt: A0A1L8HCK7
LinkDB
Position
2L:complement(14790083..14795603)
AA seq 119 aa
MIGAAKLSLILTCTKFVIAGTSCAHNAMMADISNFSYTYEDYYDYEDFASFDESDPKANK
YSIVIALWVGLAVFVVFLFLILLYMSRTVARSKNTARRKRKHMEQPKEREHGENSRNPE
NT seq 360 nt   +upstreamnt  +downstreamnt
atgataggagctgctaagctgtcgcttattctcacatgcaccaagtttgtaatagcaggt
accagttgtgctcacaatgcaatgatggccgacatcagtaacttttcctacacttatgaa
gactactatgactatgaggattttgcatccttcgatgaaagcgacccaaaagcaaataaa
tattcgattgtcattgccctttgggtcggccttgctgtttttgttgtttttctgtttctc
atactgttgtacatgtccaggaccgtcgcaagatcaaagaatacagcaagaagaaagagg
aaacacatggagcagccaaaagaaagagaacatggagaaaatagcaggaacccagaataa

DBGET integrated database retrieval system