Xenopus laevis (African clawed frog): 108709952 Help Entry 108709952         CDS       T01010                                  Name (RefSeq) high mobility group protein B1   KO K10802   high mobility group protein B1 Organism xla  Xenopus laevis (African clawed frog) Pathway xla03410   Base excision repair xla04140   Autophagy - animal xla04217   Necroptosis Brite KEGG Orthology (KO) [BR:xla00001]  09120 Genetic Information Processing   09124 Replication and repair    03410 Base excision repair     108709952  09140 Cellular Processes   09141 Transport and catabolism    04140 Autophagy - animal     108709952   09143 Cell growth and death    04217 Necroptosis     108709952  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:xla03036]     108709952    03400 DNA repair and recombination proteins [BR:xla03400]     108709952   09183 Protein families: signaling and cellular processes    04147 Exosome [BR:xla04147]     108709952 Chromosome and associated proteins [BR:xla03036]  Eukaryotic type   Nucleosome assembly factors    HMG (high mobility group) proteins     108709952 DNA repair and recombination proteins [BR:xla03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Other BER factors      108709952    MMR (mismatch excision repair)     Other MMR factors      108709952 Exosome [BR:xla04147]  Exosomal proteins   Exosomal proteins of colorectal cancer cells    108709952 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  HMG_box_2 HMG_box HMG_WDHD1 DUF4023 HMG_box_5 ANAPC15 Motif Other DBs NCBI-GeneID:  108709952 NCBI-ProteinID:  XP_018105749 UniProt:  Q6GNQ5 A0A974DJI0 LinkDB All DBs Position 2S:146178754..146188985 Genome browser AA seq 210 aa AA seqDB search MGKGDPKKPRGKMSSYAYFVQTCREEHKKKHPDASVNFAEFSKKCSERWKTMSKEKTKFE DMAKADKVRYEREMKSYIPPKGETKKRFKDPNAPKRPPSAFFLFCSDFRPKIKGEHPGST IGDIAKKLGEMWNNTATDDKLPYERRAAKLKEKYEKDVAAYRAKGKPEPAKKAPAKPEKA KKKEEDDEDDDEEEDDEEEDEEEEEDDDDE NT seq 633 nt NT seq  +upstreamnt  +downstreamnt atgggtaaaggtgatcctaagaagccaagaggaaaaatgtcctcatatgcttactttgtg caaacatgcagagaagagcacaagaaaaagcaccctgatgcctctgtaaattttgcagag ttttctaagaaatgctcagaaaggtggaagactatgtctaaggaaaagacaaagtttgaa gatatggcaaaagccgacaaagttcgctatgagagggaaatgaaaagttatattccaccc aaaggagaaacaaaaaagaggttcaaggaccctaatgcaccaaagagaccaccttcagca ttcttcttgttctgctctgacttccgcccaaaaataaaaggggagcacccaggttcgact attggagatatagcaaaaaaactgggagagatgtggaataacactgctacagatgacaaa ctgccctatgaacgaagagctgccaagctgaaggagaaatatgaaaaggatgttgcagca tatagggctaagggaaagccagaaccagcaaaaaaagctccagccaagccagaaaaagcc aagaagaaggaggaggatgatgaggatgatgatgaggaagaggatgatgaggaagaagac gaagaggaggaagaggatgatgatgacgaataa

DBGET integrated database retrieval system